Collection of considered potential humanTFs (2765 proteins)

Ensembl ID HGNC symbol DBD Family Is TF? TF Assessment Binding Activity Motif Status Notes Comments
TFAP2A AP-2 Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TFAP2B AP-2 Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TFAP2C AP-2 Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TFAP2D AP-2 Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Binds the same GCCTGAGGC sequence as the other AP-2s (PMID: 24789576)
TFAP2E AP-2 Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ARID1A ARID/BRIGHT No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Non-specific DNA binder (PMID: 15170388).
ARID1B ARID/BRIGHT No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Non-specific DNA binder (PMID: 15170388).
ARID3A ARID/BRIGHT Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
ARID3B ARID/BRIGHT Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
ARID3C ARID/BRIGHT Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
ARID4A ARID/BRIGHT No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Has a putative AT-hook Binds DNA in a sequence non-specific manner (PMID: 15640446).
ARID4B ARID/BRIGHT No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Binds DNA in a sequence non-specific manner (PMID: 15640446).
ARID5A ARID/BRIGHT Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
ARID5B ARID/BRIGHT Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro Has a putative AT-hook
JARID2 ARID/BRIGHT No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Only ARID3 and ARID5 family members have sequence specificity (PMID: 15640446).
KDM5A ARID/BRIGHT No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif
KDM5B ARID/BRIGHT Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Binds GC-rich sequences such as CCGCCC (PMID: 18270511).
KDM5C ARID/BRIGHT No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif
KDM5D ARID/BRIGHT No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Polycomb protein that is well-documented to bind histone marks (PMID: 27477906; PMID: 17351630; PMID: 17320160; PMID: 17320162).
ARID2 ARID/BRIGHT; RFX Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
AHCTF1 AT hook Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
AHDC1 AT hook Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
AKNA AT hook Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Binds AT-rich promoters of CD40 and CD40L and coordinates their expression (PMID: 11268217).
ASH1L AT hook Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
CBX2 AT hook Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
DNTTIP1 AT hook Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has a putative AT-hook
DOT1L AT hook Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
GLYR1 AT hook Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has a putative AT-hook
HMGA1 AT hook Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
HMGA2 AT hook Yes Known motif 1 Monomer or homomultimer In vivo/Misc source
PHF20 AT hook Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
PHF21A AT hook Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has a putative AT-hook
PRR12 AT hook Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
SCML4 AT hook Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
SETBP1 AT hook Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Orthologous protein from mouse (Setbp1) bind DNA sequence-specifically by PBM
SRCAP AT hook Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
C11orf95 BED ZF Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
FAM200B BED ZF Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
SGSM2 BED ZF Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZBED1 BED ZF Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZBED2 BED ZF Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has a BED domain that should bind DNA, but lacks the dimerization domain (PMID: 20016685).
ZBED3 BED ZF Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZBED4 BED ZF Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZBED5 BED ZF Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZBED6 BED ZF Yes Inferred motif 1 Monomer or homomultimer In vivo/Misc source
ZBED8 BED ZF No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Despite its name, does not have a detectable BED ZF domain.
ZBED9 BED ZF Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
AHR bHLH Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
AHRR bHLH Yes Inferred motif 1 Monomer or homomultimer In vivo/Misc source
ARNT bHLH Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
ARNT2 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ARNTL bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ARNTL2 bHLH Yes Inferred motif 2 Obligate heteromer High-throughput in vitro ARNTL2 Forms heterodimers with CLOCK and NPAS2 (PMID:10864977 ).
ASCL1 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ASCL2 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ASCL3 bHLH Yes Inferred motif 2 Obligate heteromer High-throughput in vitro ASCL1 heterodimerizes with TCF3; TCF4 and TCF12 (PMID: 24835951).
ASCL4 bHLH Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro Probably heterodimerizes with TCF3; TCF4 or TCF12 like the other ASCL TFs
ASCL5 bHLH Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro Probably heterodimerizes with TCF3; TCF4 or TCF12 like the other ASCL TFs
ATOH1 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ATOH7 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ATOH8 bHLH Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
BHLHA15 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
BHLHA9 bHLH Yes Likely to be sequence specific TF 2 Obligate heteromer No motif Protein heterodimerizes with TCF3; TCF4 and TCF12 (PMID: 25466284).
BHLHE22 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
BHLHE23 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
BHLHE40 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
BHLHE41 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
CCDC169-SOHLH2 bHLH Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
CLOCK bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Can also bind as heterodimer with ARNTL.
EPAS1 bHLH Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
FERD3L bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FIGLA bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HAND1 bHLH Yes Known motif 2 Obligate heteromer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Obligate heteromer (PMID: 10611232).
HAND2 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HELT bHLH Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro Can form homodimers or heterodimers with HEY2 and HES5, suggesting also that the HELT homodimer is dependent of a additional Orange domain while the HEY2 heterodimer requires just the DBD (PMID: 14764602).
HES1 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HES2 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HES3 bHLH Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
HES4 bHLH Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
HES5 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HES6 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HES7 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Also forms heterodimers.
HEY1 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HEY2 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HEYL bHLH Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
HIF1A bHLH Yes Known motif 2 Obligate heteromer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Binds as obligate heteromer with ARNT (PMID: 9027737).
HIF3A bHLH Yes Inferred motif 2 Obligate heteromer In vivo/Misc source Binds DNA as a heterodimer with ARNT and ARNT2; reviewed in (PMID: 24099156).
ID1 bHLH No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif ID bHLH proteins lack the basic region and should not be able to bind DNA. The HT-SELEX motif for ID4 is likely by a co-precipitated protein or it is a contamination
ID2 bHLH No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif ID bHLH proteins lack the basic region and should not be able to bind DNA. The HT-SELEX motif for ID4 is likely by a co-precipitated protein or it is a contamination
ID3 bHLH No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif ID bHLH proteins lack the basic region and should not be able to bind DNA. The HT-SELEX motif for ID4 is likely by a co-precipitated protein or it is a contamination
ID4 bHLH No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif ID bHLH proteins lack the basic region and should not be able to bind DNA. The HT-SELEX motif for ID4 is likely by a co-precipitated protein or it is a contamination
LYL1 bHLH Yes Inferred motif 2 Obligate heteromer In vivo/Misc source TAL1, TAL2 and LYL are very similar and have a basic region with a bulky tryptophan inserting into the cluster of the basic residues. Binds DNA as a heterodimer with TCF3 (PDB:2YPB and PDB:2YPA).
MAX bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
MESP1 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
MESP2 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
MITF bHLH Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro Binds DNA both as homo- and heterodimers (PMID: 23207919). The structure 4ATI is a homodimer with DNA GTTAGCACATGACCCT.
MLX bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
MLXIP bHLH Yes Inferred motif 2 Obligate heteromer High-throughput in vitro
MLXIPL bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
MNT bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Prefers to heterodimerize with MAX over homodimer formation (PMID: 9000049).
MSC bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
MSGN1 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
MXD1 bHLH Yes Inferred motif 2 Obligate heteromer In vivo/Misc source All three MXD proteins have very similar sequences and should behave accordingly, making heterodimers with at least MAX (PMID:8521822).
MXD3 bHLH Yes Inferred motif 2 Obligate heteromer In vivo/Misc source All three MXD proteins have very similar sequences and should behave accordingly, making heterodimers with at least MAX (PMID:8521822).
MXD4 bHLH Yes Inferred motif 2 Obligate heteromer In vivo/Misc source All three MXD proteins have very similar sequences and should behave accordingly, making heterodimers with at least MAX (PMID:8521822).
MXI1 bHLH Yes Known motif 2 Obligate heteromer In vivo/Misc source Has a putative AT-hook Obligate heteromer (PMID: 8425219).
MYC bHLH Yes Known motif 2 Obligate heteromer In vivo/Misc source Functions as a heterodimer with MAX.
MYCL bHLH Yes Inferred motif 2 Obligate heteromer In vivo/Misc source Similar to MYC and thus likely to functions as a heterodimer with MAX.
MYCN bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
MYF5 bHLH Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
MYF6 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
MYOD1 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
MYOG bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NCOA1 bHLH Yes Likely to be sequence specific TF 2 Obligate heteromer No motif NCOA1/2/3 all have been tested on PBMs and HT-SELEX without yielding a motif. All are co-activators, collectively suggesting they might be obligate heteromers.
NCOA2 bHLH Yes Likely to be sequence specific TF 2 Obligate heteromer No motif NCOA1/2/3 all have been tested on PBMs and HT-SELEX without yielding a motif. All are co-activators, collectively suggesting they might be obligate heteromers.
NCOA3 bHLH Yes Likely to be sequence specific TF 2 Obligate heteromer No motif NCOA1/2/3 all have been tested on PBMs and HT-SELEX without yielding a motif. All are co-activators, collectively suggesting they might be obligate heteromers.
NEUROD1 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NEUROD2 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NEUROD4 bHLH Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
NEUROD6 bHLH Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
NEUROG1 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NEUROG2 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NEUROG3 bHLH Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
NHLH1 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NHLH2 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NPAS1 bHLH Yes Inferred motif 2 Obligate heteromer In vivo/Misc source Likely obligate heteromer (PMID: 27782878).
NPAS2 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NPAS3 bHLH Yes Inferred motif 2 Obligate heteromer In vivo/Misc source Likely obligate heteromer (PMID: 9374395; PMID: 27782878).
NPAS4 bHLH Yes Inferred motif 2 Obligate heteromer High-throughput in vitro Likely dimerizes with ARNT2 (PMID:24263188).
OLIG1 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
OLIG2 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro OLIG2 can homodimerize and heterodimerize with OLIG1 and NGN2 (PMID:15655114; PMID: 21382552).
OLIG3 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PTF1A bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SCX bHLH Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro SCX heterodimerizes with TCF3 (PMID: 19828133). The Taipale lab has an unpublished HT-SELEX model; both it and the inferred B1H motif seem very weak, supporting the idea that the homodimer does not bind DNA well.
SIM1 bHLH Yes Inferred motif 2 Obligate heteromer In vivo/Misc source Similar to SIM2, which is a likely obligate heteromer.
SIM2 bHLH Yes Inferred motif 2 Obligate heteromer In vivo/Misc source Likely obligate hetereomer (PMID: 7592839)
SOHLH1 bHLH Yes Likely to be sequence specific TF 2 Obligate heteromer No motif Forms SOHLH1-SOHLH2 heterodimers (PMID: 22056784).
SOHLH2 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SREBF1 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SREBF2 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TAL1 bHLH Yes Known motif 2 Obligate heteromer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain No motif yielded from PBMs or HT-SELEX. Binds DNA as heterodimer with TCF3 (PDB:2YPB and PDB:2YPA).
TAL2 bHLH Yes Inferred motif 2 Obligate heteromer In vivo/Misc source No motif yielded from PBMs or HT-SELEX. Similar to TAL1, which binds DNA as heterodimer with TCF3 (PDB:2YPB and PDB:2YPA).
TCF12 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TCF15 bHLH Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
TCF21 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TCF23 bHLH Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro Basic region is very similar to TCF21, which binds DNA as a homodimer in HT-SELEX.
TCF24 bHLH Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
TCF3 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TCF4 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TCFL5 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TFAP4 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Also can form heterodimers (PMID: 26550823).
TFE3 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TFEB bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TFEC bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TWIST1 bHLH Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Can form both homodimers and heterodimers with TCF3 (PMID: 16502419).
TWIST2 bHLH Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
USF1 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
USF2 bHLH Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Has a putative AT-hook
USF3 bHLH Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
POGK Brinker Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
AC023509.3 bZIP Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro Identical bZIP DBD to ATF7. Some isoforms also contain a single C2H2 ZF. This is known to facilitate protein interactions in ATF7 (see ATF7 Uniprot page), so AC023509.3 is only classified here as a bZIP protein
APC2 bZIP No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Based on the alignments, the protein is only weakly related to the other bZIP proteins and lacks the basic region required for DNA binding
ATF1 bZIP Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
ATF2 bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ATF3 bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ATF4 bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ATF5 bZIP Yes Known motif 2 Obligate heteromer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Transfac motifs dont correspond to canonical bZIP binding sites. Annotated as obligate heteromer based on peptide array studies (PMID:12805554).
ATF6 bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ATF6B bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ATF7 bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Some isoforms also contain a single C2H2 ZF. This is known to facilitate protein interactions (see Uniprot page), so ATF7 is only classified here as a bZIP protein
BACH1 bZIP Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
BACH2 bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Based on Newman et al 2003 (PMID: 12805554), the protein has strong preference for forming heterodimers with MAFG and MAFK over homo-dimerisation. The Homer ChIP-seq motif appears to be a MAF-BACH2 heterodimer.
BATF bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Prefers to heterodimerize, but it has an HT-SELEX (homodimer) motif. Its homodimerization Kd is 184nM and its best heterodimer is with CEBPG (<1nM) (PMID: 23661758).
BATF2 bZIP Yes Likely to be sequence specific TF 2 Obligate heteromer No motif Part of AP-1 complex - there is no evidence it can bind on its own as a homodimer.
BATF3 bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Transfac motif is dubious.
BEND4 bZIP No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Lacks the basic region of the bZIP domain.
CCDC3 bZIP No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif bZIP domain is truncated and lacks the DNA-contacting residues.
CCDC83 bZIP No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif bZIP domains are truncated, such that they are likely just coiled-coiled regions with no DNA-binding ability.
CEBPA bZIP Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
CEBPB bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
CEBPD bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro CEBPD binds as both a homodimer and as a heterdimer with other C/EBP TFs (PMID: 1884998; PMID: 12805554).
CEBPE bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Also forms heterodimers.
CEBPG bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
CREB1 bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
CREB3 bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
CREB3L1 bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
CREB3L2 bZIP Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
CREB3L3 bZIP Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Gel-shift and reporter experiments demonstrate that CREB3L3 is a TF (PMID: 11353085).
CREB3L4 bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
CREB5 bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
CREBL2 bZIP Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
CREBRF bZIP No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Tested on HT-SELEX and did not yield a motif. Binds to CREB3 and represses the unfolded protein response (PMID: 18391022).
CREBZF bZIP Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
CREM bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
DBP bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
DDIT3 bZIP Yes Known motif 2 Obligate heteromer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Has strong preference for forming heterodimers with BATF; DBP; HLF; CEBP[ABCD] over homodimerization (PMID: 12805554).
FOS bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FOSB bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FOSL1 bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FOSL2 bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Also forms heterodimers.
GULP1 bZIP No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Based on the alignments, the protein is only weakly related to the other bZIP proteins and lacks the basic region required for DNA binding
HLF bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOOK2 bZIP No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Based on the alignments, the protein is only weakly related to the other bZIP proteins and lacks the basic region required for DNA binding
IQGAP1 bZIP No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif bZIP domain in the protein is just a fragment.
JDP2 bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
JUN bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
JUNB bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Prefers forming heterodimers with FOS; FOSB; FOSL1 and FOSL2 over homodimers (PMID:12805554); but, clearly can bind DNA specifically in vitro.
JUND bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
KIF15 bZIP No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a bZIP like fragment that lacks the basic region required for DNA binding and a STE-domain that is classified as a potential DBD in CIS-BP. It is a kinesin operating in the microtubule system (PMID: 24419385)
KRT13 bZIP No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Based on the alignments, the protein is only weakly related to the other bZIP proteins and lacks the basic region required for DNA binding
MAF bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
MAFA bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
MAFB bZIP Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro PDB:2WTY is a homodimer crystallised with TAATTGCTGACTCAGCAAAT sequence
MAFF bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
MAFG bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
MAFK bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
MORC3 bZIP No ssDNA/RNA binding 4 Not a DNA binding protein No motif Lacks a canonical bZIP DBD but: regulates TP53 activity (PMID: 17332504]), binds RNA in vitro (PMID: 11927593), and may be required for influenza A transcription during viral infection (PMID: 26202233).
NDC80 bZIP No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Based on the alignments, the protein is only weakly related to the other bZIP proteins and lacks the basic region required for DNA binding
NFE2 bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NFE2L1 bZIP Yes Known motif 2 Obligate heteromer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Tested on HT-SELEX and PBM. Neither yielded a motif. Likely an obligate heteromer (PMID: 23661758).
NFE2L2 bZIP Yes Known motif 2 Obligate heteromer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Has been tested by both PBM and HT-SELEX. Neither yielded a motif. Likely obligate heteromer.
NFE2L3 bZIP Yes Known motif 2 Obligate heteromer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Tested on HT-SELEX and PBM. Neither yielded a motif. Likely an obligate heteromer (PMID: 23661758). Strong preference for forming heterodimers with MAFG and MAFK over homodimers (PMID: 12805554).
NFIL3 bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NRBF2 bZIP No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Based on the alignments, the protein is only weakly related to the other bZIP proteins and lacks the basic region required for DNA binding
NRL bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PPP1R21 bZIP No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein lacks the basic region these proteins use to contact the DNA
RAB11FIP4 bZIP No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Likely false-positive - appears to function primarily in the cytoplasm (PMID: 12470645).
RNF219 bZIP No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Not a proper bZIP; contains only a small leucine zipper region but lacks the DNA-interfacing basic part.
SCOC bZIP No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Not a proper bZIP; contains only a small leucine zipper region but lacks the DNA-interfacing basic part.
TEF bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TRAK2 bZIP No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif The bZIP domain is only a partial 40AA sequence that will not bind DNA.
XBP1 bZIP Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
AC008770.3 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
AC092835.1 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif KRAB C2H2 Protein
AC138696.1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
AEBP2 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
AKAP8 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain (PMID: 26683827) uses SELEX to show binding to G/C rich DNA, and confirms association with rDNA promoters. Also claims it has a C2H2 domain. Interpro says it has a C2H2 AKAP95-type 1 and a C2H2 AKAP95-type 2 domain. SMART does identify a single C2H2 domain.
AKAP8L C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain This is homologous to the AKAP8/AKAP95 protein. which has been shown by SELEX to bind GC rich sequences (PMID: 26683827).
ANKZF1 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain
ATMIN C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
BCL11A C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source
BCL11B C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
BCL6 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
BCL6B C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
BNC1 C2H2 ZF(non-KRAB) Yes Inferred motif 1 Monomer or homomultimer In vivo/Misc source
BNC2 C2H2 ZF(non-KRAB) Yes Inferred motif 1 Monomer or homomultimer In vivo/Misc source Has a putative AT-hook
CASZ1 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
CCDC17 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain
CHAMP1 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain
CPXCR1 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain
CTCF C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Has a putative AT-hook
CTCFL C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source
DPF1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro This protein contains C2H2 ZFs missed by Pfam scanning.
DPF3 C2H2 ZF(non-KRAB) Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro Single C2H2 domain Single C2H2 ZF. PHD domains mediate recognition of acetylated histones (PMID: 20613843); unclear if the ZF contributes DNA-binding specificity to the interaction.
DZIP1 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain; Has a putative AT-hook
E4F1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
EEA1 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain Based on (PMID: 20534488), the protein has a C2H2 ZF domain; but it uses the domain for contacting RAB5A rather than for binding DNA.
EGR1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
EGR2 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Binds HOX4A promoter (PMID:21836637)
EGR3 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
EGR4 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FAM170A C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain Degenerate C2H2-ZFP. Localizes to the nucleus and overexpression upregulates other genes (PMID: 20162441).
FEZF1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
FEZF2 C2H2 ZF(non-KRAB) Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
FIZ1 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Protein has a decent cassette of C2H2 ZF domains (not all are detected by Pfam). It has been also shown to interact with homeodomain protein CRX (PMID: 18854042) and MAF-subtype bZIP protein NRL (PMID: 12566383).
GFI1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
GFI1B C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
GLI1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source
GLI2 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
GLI3 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
GLI4 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect Protein is not closely homologous to GLI1-3 proteins.
GLIS1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
GLIS2 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
GLIS3 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
GTF3A C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
GZF1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
HIC1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HIC2 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HINFP C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HIVEP1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
HIVEP2 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
HIVEP3 C2H2 ZF(non-KRAB) Yes Inferred motif 1 Monomer or homomultimer In vivo/Misc source Has a putative AT-hook Binds to NFKB-like consensus sequence to repress transcription (PMID: 21189157). PWMs for HIVEP1 and 2 in Transfac and Hocomoco are also NFKB-like.
HKR1 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
IKZF1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
IKZF2 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
IKZF3 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
IKZF4 C2H2 ZF(non-KRAB) Yes Inferred motif 1 Monomer or homomultimer In vivo/Misc source
IKZF5 C2H2 ZF(non-KRAB) Yes Inferred motif 1 Monomer or homomultimer In vivo/Misc source
INSM1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source
INSM2 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
JAZF1 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
KAT7 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
KCMF1 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain No evidence of DNA-binding in the literature; and has evidence of E3 ligase activity (PMID:15581609).
KIN C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain Binds curved DNA (PMID: 8078469).
KLF1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
KLF10 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
KLF11 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
KLF12 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
KLF13 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
KLF14 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
KLF15 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
KLF16 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
KLF17 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
KLF2 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
KLF3 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
KLF4 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
KLF5 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Binds as a monomer and as a dimer (PMID: 25575120).
KLF6 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
KLF7 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
KLF8 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
KLF9 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
L3MBTL1 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Histone modifier; polycomb protein.
L3MBTL3 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Histone modifier; polycomb protein.
L3MBTL4 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Histone modifier; polycomb protein.
MAZ C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
MECOM C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
MTF1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
MYNN C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
MYT1 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Crystal structure (PDB:2JX1) has GTGAACTTTCGGT DNA; similar to MYT1L SELEX and PBM sites.
MYT1L C2H2 ZF(non-KRAB) Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
MZF1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source
NUFIP1 C2H2 ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif Single C2H2 domain This is a known RNA-binding protein with a single C2H2 domain. TF-CAT considered it a candidate TF; but in the ten years since; no such evidence has emerged.
OSR1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
OSR2 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
OVOL1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
OVOL2 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
OVOL3 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
PEG3 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif SCAN C2H2 ZF Protein.
PLAG1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PLAGL1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
PLAGL2 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PRDM1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PRDM10 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has a putative AT-hook
PRDM12 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
PRDM13 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
PRDM14 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source
PRDM15 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
PRDM16 C2H2 ZF(non-KRAB) Yes Inferred motif 1 Monomer or homomultimer In vivo/Misc source
PRDM2 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has been suggested to function as a histone methyltransferase (PMID: 15282304), but it has a decent set of C2H2 ZF domains and could thus bind DNA independently.
PRDM4 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PRDM5 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has a nice cassette of C2H2 ZF domains. Moreover, (PMID: 17636019) has performed SELEX for it and validated the result.
PRDM6 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
PRDM8 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
PRDM9 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
PRMT3 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain Has a single C2H2 ZF (PMID: 10931850).
RBAK C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
RBSN C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain Potential false positive - protein functions in membrane trafficking.
REPIN1 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Binds DNA specifically based on EMSA and nuclease footprinting (PMID: 10606657).
REST C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source
RLF C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
RREB1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source
SALL1 C2H2 ZF(non-KRAB) Yes Inferred motif 1 Monomer or homomultimer In vivo/Misc source
SALL2 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
SALL3 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
SALL4 C2H2 ZF(non-KRAB) Yes Inferred motif 1 Monomer or homomultimer In vivo/Misc source
SCRT1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SCRT2 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SLC2A4RG C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain Two papers demonstrate a bit of evidence for DNA binding (PMID:10825161 and PMID: 14625278 ).
SNAI1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SNAI2 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SNAI3 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SP1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SP2 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SP3 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SP4 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SP5 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Transfac motif has some similarity to known Sp1 TF motifs from multiple species and sources
SP6 C2H2 ZF(non-KRAB) Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
SP7 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
SP8 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SP9 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ST18 C2H2 ZF(non-KRAB) Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
TRAFD1 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain Possible false positive: the protein negatively regulates IRF3 and NFKB but there is no evidence for DNA-binding and it is likely to operate upstream on the signalling cascade (PMID:18849341).
TSHZ1 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
TSHZ2 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Also contains an atypical homodomain (Uniprot) not identified by Pfam.
TSHZ3 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif The C2H2 domains are too spread out to be credible; but there is also a homodomain. Seems more likely than not that it binds DNA.
VEZF1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
WIZ C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has a putative AT-hook Regulates the G9aGLP complex for gene repression; has a ChIP-seq derived DNA-binding motif (PMID:25789554).
WT1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Crystal structure (PDB:2JP9) is with dsDNA GCGCAGACGCCCCCGCG, which is consistent with the PWMs
YY1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
YY2 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZBTB1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
ZBTB10 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a BTB homodimerization domain
ZBTB11 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
ZBTB12 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZBTB14 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZBTB16 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
ZBTB17 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZBTB18 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZBTB2 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZBTB20 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZBTB21 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a BTB homodimerization domain
ZBTB22 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZBTB25 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZBTB26 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZBTB3 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
ZBTB32 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZBTB33 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source
ZBTB34 C2H2 ZF(non-KRAB) Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
ZBTB37 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZBTB38 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif It has a decent cassette of znfC2H2 domains and a BTB homodimerization domain. Requires CpG methylation for binding into a site in MYOG-promoter (PMID: 21625269).
ZBTB39 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZBTB4 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
ZBTB40 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a BTB homodimerization domain
ZBTB41 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZBTB42 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZBTB43 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZBTB44 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZBTB45 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZBTB46 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Specificity is unknown; functions in dendritic cells (PMID: 22615130).
ZBTB47 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZBTB48 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZBTB49 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZBTB5 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain Binds to GATCGGGCGGGGCGGTTGTATATCA; GATCCGTTAGAGGAAGAAGACTGGGCATGTCTG and GATCCATCAGGAACATGTCCCAACATGTTGAGCTC based on EMSA using recombinant protein (PMID: 19491398).
ZBTB6 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZBTB7A C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZBTB7B C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZBTB7C C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZBTB8A C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a two znfC2H2 domains and a BTB-domain
ZBTB8B C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a BTB homodimerization domain
ZBTB9 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has two znfC2H2 domains and a BTB-domain that typically mediates homotypic dimerization
ZFAT C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has a putative AT-hook
ZFP1 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZFP14 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZFP2 C2H2 ZF(non-KRAB) Yes Inferred motif 1 Monomer or homomultimer In vivo/Misc source
ZFP28 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE); Has a putative AT-hook
ZFP3 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZFP30 C2H2 ZF(KRAB) Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
ZFP37 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZFP41 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZFP42 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZFP57 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect Recognizes CpG methylated ACTGCGGCAAT site based on structure 4GZN
ZFP62 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains
ZFP64 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZFP69 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZFP69B C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZFP82 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZFP90 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZFP91 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Possible false positive. An Atypical E3 ubiquitin-protein ligase that mediates Lys-63-linked ubiquitination of MAP3K14/NIK; leading to stabilization and activation of MAP3K14/NIK. It thereby acts as an activator of the non-canonical NF-kappa-B2/NFKB2 pathway (PMID: 20682767).
ZFP92 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain
ZFPL1 C2H2 ZF No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a Golgi apparatus integral membrane protein with RING-type zinc fingers (PMID:18323775 ).
ZFPM1 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZFPM2 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif FOG-proteins use some of their zinc-fingers to interact with the GATA proteins. Other C2H2 ZFs are probably also capable of binding DNA (PMID: 10329627).
ZFR C2H2 ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
ZFR2 C2H2 ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif ZFR2 contains only RNA-binding zinc fingers
ZFX C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
ZFY C2H2 ZF(non-KRAB) Yes Inferred motif 1 Monomer or homomultimer In vivo/Misc source
ZIC1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZIC2 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
ZIC3 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZIC4 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZIC5 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZIK1 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZIM2 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect Binds GKGGSWST consensus with GTGGCAGT as the optimal site based on competition EMSA (PMID: 26692216).
ZIM3 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZKSCAN1 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZKSCAN2 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZKSCAN3 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZKSCAN4 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZKSCAN5 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZKSCAN7 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZKSCAN8 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain
ZMAT1 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain Possible RBP.
ZMAT3 C2H2 ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif Protein binds RNA (PMID: 19805223 and PMID: 16844115).
ZMAT4 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Possible RBP.
ZNF10 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF100 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF101 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF106 C2H2 ZF No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif C2H2 ZFs are not present in most isoforms; of which most contain WD40 repeats. Previous annotations (TFCat) suggest role as a cofactor (PMID: 15833274).
ZNF107 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain
ZNF112 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has a nice cassette of znfC2H2 domains and a KRAB-domain; virtually nothing is known about it.
ZNF114 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF117 C2H2 ZF(non-KRAB) Yes Inferred motif 1 Monomer or homomultimer In vivo/Misc source
ZNF12 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF121 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF124 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF131 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Evidence for DNA binding (PMID: 20303951 ).
ZNF132 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF133 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF134 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF135 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF136 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF138 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF14 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains
ZNF140 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF141 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF142 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF143 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF146 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF148 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
ZNF154 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF155 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF157 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF16 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF160 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain
ZNF165 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a SCAN-domain and that it appears to be expressed commonly in urinary bladder cancers PMID: 25214475
ZNF169 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF17 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF174 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF175 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF177 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF18 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF180 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF181 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF182 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF184 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF189 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF19 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF195 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Kruppel family C2H2 ZF.
ZNF197 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF2 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF20 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF200 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF202 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF205 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF207 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF208 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF211 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF212 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF213 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE); Has a putative AT-hook
ZNF214 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF215 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF217 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Based on (PDB: 3UK3) this protein has at least two DNA binding znf domains. In vitro evidence for DNA binding (PMID:17130829).
ZNF219 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Binds CCCCCA based on SELEX (PMID: 14621294).
ZNF22 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF221 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF222 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF223 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF224 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF225 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF226 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF227 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF229 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain
ZNF23 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF230 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has nice array of znf domains and a KRAB domain
ZNF232 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF233 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF234 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF235 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF236 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
ZNF239 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Binds TAAAGGCT based on EMSA (PMID: 11278819).
ZNF24 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF248 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF25 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF250 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF251 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain
ZNF253 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain
ZNF254 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF256 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain
ZNF257 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF26 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF260 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF263 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF264 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF266 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF267 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF268 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Contains znfC2H2 domains and a KRAB-domain; linked to cervical cancer through effects on NFKB-signaling (PMID: 23091055).
ZNF273 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF274 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF275 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF276 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF28 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF280A C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF280B C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF280C C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF280D C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF281 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF282 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF283 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF284 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF285 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF286A C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain
ZNF286B C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains
ZNF287 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF292 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF296 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF3 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF30 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF300 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF302 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF304 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF311 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF316 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
ZNF317 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF318 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Possible RNA-binding protein; it has two u1 type ZNF domains (PMID: 25057009).
ZNF319 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains
ZNF32 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF320 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF322 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF324 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF324B C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF326 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif ZNF326 is a member of the DBIRD complex that regulates splicing by binding to PolII in an RNA-independant manner (PMID:22446626).
ZNF329 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF331 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF333 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF334 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF335 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has a putative AT-hook
ZNF337 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF33A C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF33B C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF34 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF341 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF343 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF345 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF346 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Binds dsDNA with low affinity and no discernible specificity (PMID: 24521053).
ZNF347 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF35 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF350 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF354A C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF354B C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF354C C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source
ZNF355P C2H2 ZF No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Pseudogene
ZNF358 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF362 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains
ZNF365 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain Also contains a Ku C terminal like domain that is thought to be involved in DNA-damage repair pathways.
ZNF366 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif This protein has been shown to complex with and function as a corepressor for ESR1 (PMID: 17085477) and glucocorticoid receptor (PMID: 23440419). It has a nice set of znfs and could thus well bind DNA independently.
ZNF367 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has a putative AT-hook Virtually nothing is known for this protein except that it has two znfC2H2 domains next to each other
ZNF37A C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF382 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF383 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF384 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF385A C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF385B C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF385C C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF385D C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF391 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF394 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF395 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain Contains a single ZF (string matching on Uniprot) that is not identified using Pfam HMM thresholds. Shown to bind a short DNA sequence (GCCGGCG) by EMSA and DNase I footprinting (PMID:14625278).
ZNF396 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF397 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and that it binds on centromeric regions PMID: 18369653
ZNF398 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF404 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain
ZNF407 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has a putative AT-hook Protein has a decent cassette of znfC2H2 domains; a study links it in regulation of glucose intake receptor GLUT4 (PMID: 25596527).
ZNF408 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF41 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF410 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF414 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Its on the low end of confidence that its a TF; since most of the domains are variants of C2H2; but its more likely than not since they are in a row.
ZNF415 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF416 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source
ZNF417 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF418 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF419 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF420 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF423 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
ZNF425 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF426 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF428 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain
ZNF429 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF43 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF430 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF431 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF432 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF433 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF436 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF438 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has two znfC2H2 domains and that it represses transcription in a reporter assay PMID: 17669267
ZNF439 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF44 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF440 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF441 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF442 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF443 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF444 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF445 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF446 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Contains three znfC2H2 domains and represses transcription when expressed as GAL4 fusion (PMID:15936718).
ZNF449 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF45 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF451 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF454 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF460 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF461 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Protein has a decent cassette of znfC2H2 domains and a KRAB-domain. It has been shown also to operate as a corepressor of NR5A1, where the KRAB-domain ).mediates both the interaction to NR5A1 and to HDAC2 (PMID: 16595694
ZNF462 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has many znfC2H2 like domains that are however not in tight arrays but interspersed throughout the sequence
ZNF467 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF468 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF469 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has a putative AT-hook
ZNF470 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has a possible role in chondrocytes (PMID: 15302581). It has a decent cassette of znfC2H2 domains and a KRAB-domain.
ZNF471 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF473 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF474 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain
ZNF479 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF48 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF480 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF483 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF484 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF485 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF486 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF487 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Single C2H2 domain; Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF488 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has two znfC2H2 domains
ZNF490 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF491 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains
ZNF492 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF493 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF496 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF497 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF500 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF501 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF502 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF503 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain
ZNF506 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE) Has a nice cassette of znfC2H2 domains and a KRAB domain
ZNF507 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF510 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has decent cassettes of znfC2H2 domains
ZNF511 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF512B C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has a putative AT-hook Protein has znfC2H2 domains but they are fragmented rather than making decent cassettes
ZNF513 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF514 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF516 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF517 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF518A C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and that it interacts with polycomb repressor complex 2 PMID: 25680957
ZNF518B C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF519 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF521 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
ZNF525 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF526 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains
ZNF527 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF528 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF529 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF530 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF532 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has decent cassettes of znfC2H2 domains
ZNF534 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF536 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF540 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF542P C2H2 ZF No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Pseudogene
ZNF543 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF544 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF546 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain
ZNF547 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF548 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF549 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF550 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF551 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF552 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF554 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF555 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF556 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain
ZNF557 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF558 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF559 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF560 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF561 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF562 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF563 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF564 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF565 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF566 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF567 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF568 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF569 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF57 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has a nice cassette of znfC2H2 domains and has been shown to be expressed in many tissues and to be able to repress transcription (PMID: 20356463).
ZNF570 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF571 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF572 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains
ZNF573 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF574 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF575 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF576 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF577 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF578 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain
ZNF579 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF580 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF581 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
ZNF582 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF583 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF584 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF585A C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF585B C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF586 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF587 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF587B C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain
ZNF589 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
ZNF592 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF593 C2H2 ZF No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein has a single atypical znfC2H2 domain that has been shown to inhibit binding of POU2F2 to DNA by interacting with POU2F2 (PMID: 18287285).
ZNF594 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF595 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF596 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF597 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF598 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF599 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain
ZNF600 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF605 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF606 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF607 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain
ZNF608 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain
ZNF609 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain
ZNF610 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF611 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF613 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF614 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF615 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF616 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF618 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF619 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF620 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF621 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF622 C2H2 ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif ZNF622 lacks canonical Pfam matches to C2H2 domains and appears to have better homology to U1-type 1 ZFs involved in RNA recognition. Previous evidence for TF activity (PMID:12645566) was based on transcriptional regulation; and not DNA-binding.
ZNF623 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF624 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF625 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain
ZNF626 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF627 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF628 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains. The transfac model doesnt look like a common suspect
ZNF629 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF630 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF639 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Promotes transcription of HIV genes (PMID: 24204263).
ZNF641 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF644 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Possible false positive. Arrangement of C2H2 domains seems inconsistent with DNA binding.
ZNF645 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain
ZNF646 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains
ZNF648 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF649 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF652 C2H2 ZF(non-KRAB) Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
ZNF654 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF655 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains
ZNF658 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source
ZNF66 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF660 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF662 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF664 C2H2 ZF(non-KRAB) Yes Inferred motif 1 Monomer or homomultimer In vivo/Misc source
ZNF665 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF667 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF668 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF669 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF670 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has a nice cassette of znfC2H2 domains and a KRAB domain
ZNF671 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF672 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains
ZNF674 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF675 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF676 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF677 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF678 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF679 C2H2 ZF(KRAB) Yes Inferred motif 1 Monomer or homomultimer In vivo/Misc source
ZNF680 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF681 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF682 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF683 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF684 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF687 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF688 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF689 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain and that it downregulates expression of BCL2 proteins in some types of liver cancer PMID: 21624362
ZNF69 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF691 C2H2 ZF(non-KRAB) Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
ZNF692 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF695 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF696 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF697 C2H2 ZF(non-KRAB) Yes Inferred motif 1 Monomer or homomultimer In vivo/Misc source
ZNF699 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain
ZNF7 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF70 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF700 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF701 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF703 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain
ZNF704 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Single C2H2 domain
ZNF705A C2H2 ZF(KRAB) Yes Inferred motif 1 Monomer or homomultimer In vivo/Misc source Contains decent cassette of znfC2H2 domains and a KRAB-domain.
ZNF705B C2H2 ZF(KRAB) Yes Inferred motif 1 Monomer or homomultimer In vivo/Misc source
ZNF705D C2H2 ZF(KRAB) Yes Inferred motif 1 Monomer or homomultimer In vivo/Misc source
ZNF705E C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has a nice cassette of znfC2H2 domains and a KRAB domain
ZNF705G C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF706 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain
ZNF707 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF708 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF709 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF71 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF710 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known about this protein except that it has a nice array of znfC2H2 domains
ZNF711 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source
ZNF713 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF714 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF716 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF717 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF718 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
ZNF721 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain
ZNF724 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain.
ZNF726 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain
ZNF727 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
ZNF728 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain
ZNF729 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain
ZNF73 C2H2 ZF No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Pseudogene; Only known motifs are from Transfac or HocoMoco - origin is uncertain Pseudogene
ZNF730 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF732 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF735 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
ZNF736 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF737 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF74 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF740 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF746 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF747 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF749 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF750 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain; Has a putative AT-hook Influences KLF4 expression (PMID: 22364861).
ZNF75A C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF75D C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF76 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF761 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
ZNF763 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF764 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF765 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF766 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF768 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF77 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF770 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF771 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF772 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF773 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain
ZNF774 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF775 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a MBD domain
ZNF776 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF777 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF778 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF780A C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF780B C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF781 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF782 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF783 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF784 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF785 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF786 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF787 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF788 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains
ZNF789 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF79 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF790 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF791 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF792 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF793 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF799 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF8 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF80 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains.
ZNF800 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif C2H2 domains are not arranged in the stereotypic array fashion; but there are several of them.
ZNF804A C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain
ZNF804B C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain Jaz domain suggests RNA-binding activity
ZNF805 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF808 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF81 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF812P C2H2 ZF No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Pseudogene
ZNF813 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has a nice cassette of znfC2H2 domains and a KRAB domain
ZNF814 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF816 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF821 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF823 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF827 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has been shown to operate on telomeres and recruit the NuRD complex into them (PMID: 25150861).
ZNF829 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF83 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains
ZNF830 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain Possible false positive. The C2H2 domain is a weak match, and doesnt come up on SMART or PFAM. Mouse ortholog is involved in DNA replication and repair (PMID: 25168238; PMID: 21191184).
ZNF831 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF835 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains
ZNF836 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain
ZNF837 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has a nice cassette of znfC2H2 domains; virtually nothing is known about it otherwise.
ZNF839 C2H2 ZF No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif The single C2H2 domain has an insertion between the Hs. Also; it is embedded within the DUF4764 domain; which encompasses most of the protein. Its not located in the usual C2H2 loci.
ZNF84 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF841 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain
ZNF843 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Single C2H2 domain
ZNF844 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain
ZNF845 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain
ZNF846 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZNF85 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF850 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF852 C2H2 ZF(KRAB) Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain
ZNF853 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains
ZNF860 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF865 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF878 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF879 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF880 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF883 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
ZNF888 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif One transcript is protein-coding
ZNF891 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF90 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF91 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF92 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a KRAB-domain
ZNF93 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE) Kruppel family C2H2 ZF.
ZNF98 C2H2 ZF(KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZNF99 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZSCAN1 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZSCAN10 C2H2 ZF(non-KRAB) Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
ZSCAN12 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a SCAN-domain
ZSCAN16 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZSCAN18 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZSCAN2 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a SCAN-domain
ZSCAN20 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZSCAN21 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Binds AGYACNNNNNNNGGYAC consensus based on SELEX (PMID: 8625807).
ZSCAN22 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZSCAN23 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZSCAN25 C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a decent cassette of znfC2H2 domains and a SCAN-domain
ZSCAN26 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
ZSCAN29 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Has a putative AT-hook
ZSCAN30 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZSCAN31 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE) Also known as ZNF323
ZSCAN32 C2H2 ZF(KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZSCAN4 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZSCAN5A C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZSCAN5B C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZSCAN5C C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro ChIP-seq motif is consistent with recognition code (RCADE)
ZSCAN5DP C2H2 ZF No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Pseudogene
ZSCAN9 C2H2 ZF(non-KRAB) Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZUFSP C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZXDA C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Complexes with CIITA and the similar protein ZXDC to regulate MHCII complex transcription (PMID: 17493635).
ZXDB C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZXDC C2H2 ZF(non-KRAB) Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
PATZ1 C2H2 ZF; AT hook Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Motif obtained from MEME - not supported by recognition code (RCADE) and may be inaccurate or indirect
ZBTB24 C2H2 ZF; AT hook Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZNF524 C2H2 ZF; AT hook Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZNF653 C2H2 ZF; AT hook Yes Known motif 1 Monomer or homomultimer In vivo/Misc source
ZNF277 C2H2 ZF; BED ZF Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has a some znfC2H2 and znfBED domains
ZNF512 C2H2 ZF; BED ZF Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Virtually nothing is known for this protein except that it has some of znfC2H2 domains and a znfBED domain and could thus be a TF
ZEB1 C2H2 ZF; Homeodomain Yes Known motif 1 Monomer or homomultimer In vivo/Misc source
ZEB2 C2H2 ZF; Homeodomain Yes Inferred motif 1 Monomer or homomultimer In vivo/Misc source
ZFHX3 C2H2 ZF; Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZFHX4 C2H2 ZF; Homeodomain Yes Inferred motif 1 Monomer or homomultimer In vivo/Misc source Curious protein with numerous C2H2 and homeodomain-like domains.
TRERF1 C2H2 ZF; Myb/SANT Yes Inferred motif 1 Monomer or homomultimer In vivo/Misc source Contains a SANT and multiple DNA-binding C2H2 domains.
ZNF541 C2H2 ZF; Myb/SANT Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Has good looking ZF arrays and possible Myb domains.
NFYA CBF/NF-Y Yes Known motif 2 Obligate heteromer In vivo/Misc source Binds as a trimer with NFYB and NFYC.
CPSF4 CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
CPSF4L CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
DHX57 CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
DUS3L CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
HELZ CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
MBNL1 CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
MBNL2 CCCH ZF Yes Likely to be sequence specific TF 1 Monomer or homomultimer High-throughput in vitro Has methylated and unmethylated HT-SELEX motifs, despite this family largely binding RNA exclusively (PMID: 28473536 )
MBNL3 CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
MKRN1 CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
MKRN2 CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
NUPL2 CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
PARP12 CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif Likely an RNA binding protein (PMID: 25086041).
PPP1R10 CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif Close ortholog (PP1RA) binds to mRNA, single-stranded DNA (ssDNA), poly(A) and poly(G) homopolymers (Uniprot).
PRR3 CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
RC3H1 CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif A well established RNA-binding protein reviewed in (PMID: 26489670).
RC3H2 CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
RNF113A CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
RNF113B CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
TOE1 CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
TRMT1 CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
UNK CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
UNKL CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
ZC3H10 CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
ZC3H11A CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
ZC3H12A CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
ZC3H13 CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
ZC3H14 CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif Binds UUUNUUU RNA-sequence based on Ray et al 2013 (PMID: 23846655).
ZC3H15 CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
ZC3H18 CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
ZC3H3 CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
ZC3H4 CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif Has a putative AT-hook
ZC3H6 CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
ZC3H7A CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
ZC3H7B CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
ZC3H8 CCCH ZF Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Mouse ortholog can bind DNA specifically, based on EMSA (PMID: 12077251).
ZC3HAV1 CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif RNA-binding protein (PMID: 22658674; PMID: 22681889).
ZFP36 CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif RNA binding protein (PMID: 10330172).
ZFP36L1 CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif RNA-binding protein (PMID: 27102483; PMID: 17013884).
ZFP36L2 CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif RNA-binding protein (PMID: 20506496).
ZGPAT CCCH ZF Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Binds RRRGGAGGAGA based on SELEX and EMSA (PMID: 19644445).
ZMAT5 CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
ZRSR1 CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
ZRSR2 CCCH ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif
CENPB CENPB Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
CENPBD1 CENPB Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
JRK CENPB Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
JRKL CENPB Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
TIGD1 CENPB Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TIGD2 CENPB Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
TIGD3 CENPB Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
TIGD4 CENPB Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Evidence showing that the two HTH domains in the protein together bind specifically to a 17-base-pair sequence; the CENP-B box; which occurs in alpha-satellite DNA in human centromeres (PMID: 16183641).
TIGD5 CENPB Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
TIGD6 CENPB Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
TIGD7 CENPB Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
CAMTA1 CG-1 Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Binds CGCATTGCG based on EMSA performed in (PMID: 25049392)
CAMTA2 CG-1 Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
CARHSP1 CSD No ssDNA/RNA binding 4 Not a DNA binding protein No motif RNA-binding protein (PMID: 11842224; PMID: 21078874)
CSDC2 CSD No ssDNA/RNA binding 4 Not a DNA binding protein No motif RNA-binding protein (PMID: 12801884)
CSDE1 CSD No ssDNA/RNA binding 4 Not a DNA binding protein No motif Established RNA-binding protein.
LIN28A CSD Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro Might also bind RNA
LIN28B CSD Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Structure (PDB: 4A75) is with single stranded DNA.
YBX1 CSD Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Might also bind RNA
YBX2 CSD Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro Might also bind RNA
YBX3 CSD Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro Identical DBD to YBX1. Might also bind RNA.
RBPJ CSL Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
RBPJL CSL Yes Inferred motif 1 Monomer or homomultimer In vivo/Misc source
CUX1 CUT; Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
CUX2 CUT; Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ONECUT1 CUT; Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ONECUT2 CUT; Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ONECUT3 CUT; Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SATB1 CUT; Homeodomain Yes Known motif 3 Low specificity DNA-binding protein In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain SATBs were analyzed by Gwenael Badis and Mike Berger a decade ago; by PBMs. It did not yield a motif; instead; the signal was very closely proportional to nucleotide content, as the name suggests (Special AT Binding).
SATB2 CUT; Homeodomain Yes Inferred motif 3 Low specificity DNA-binding protein In vivo/Misc source SATBs were analyzed by Gwenael Badis and Mike Berger a decade ago; by PBMs. It did not yield a motif; instead; the signal was very closely proportional to nucleotide content, as the name suggests (Special AT Binding).
CXXC1 CxxC Yes Known motif 1 Monomer or homomultimer High-throughput in vitro X-ray structure (PDB:3QMI) indicates sequence specific binding through base contacts (PMID: 21407193).
CXXC4 CxxC Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Binds unmethylated CpG-rich sequences: (PMID: 23563267).
CXXC5 CxxC Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
DNMT1 CxxC Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FBXL19 CxxC Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
KDM2A CxxC Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has a CXXC zinc finger that recognizes CGs (PMID: 22083960)
KDM2B CxxC Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TET1 CxxC Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TET3 CxxC Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
KMT2A CxxC; AT hook Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Contains 3 AT-hook domain, a CXXC domain, and a possible C2H2 domain.
KMT2B CxxC; AT hook Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Structural evidence shows direct DNA-binding (PDB:4PZI) and KMT2B appears to make specific contacts with methylated DNA.
DMRT1 DM Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
DMRT2 DM Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
DMRT3 DM Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
DMRTA1 DM Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
DMRTA2 DM Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
DMRTB1 DM Yes Likely to be sequence specific TF 2 Obligate heteromer No motif
DMRTC2 DM Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
E2F1 E2F Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
E2F2 E2F Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Can also bind as a heterodimer with DP1 (PMID: 16360038)
E2F3 E2F Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Binds preferentially with DP proteins in vivo
E2F4 E2F Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
E2F5 E2F Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Also heterodimerzes with DP2 (PMID: 7760804)
E2F6 E2F Yes Known motif 1 Monomer or homomultimer In vivo/Misc source
E2F7 E2F Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
E2F8 E2F Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TFDP1 E2F Yes Known motif 2 Obligate heteromer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
TFDP2 E2F Yes Inferred motif 2 Obligate heteromer In vivo/Misc source
TFDP3 E2F Yes Inferred motif 2 Obligate heteromer In vivo/Misc source Interacts with E2F1; E2F2; E2F3; E2F4 and E2F5 (PMID: 17062573).
EBF1 EBF1 Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
EBF2 EBF1 Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain EBF1 has a nice HT-SELEX model and based on this paper (PMID:23499423). EBF2 binds similar motif to control brown/beige fat cell identity.
EBF3 EBF1 Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
EBF4 EBF1 Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
EHF Ets Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ELF1 Ets Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ELF2 Ets Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ELF4 Ets Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ELF5 Ets Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ELK1 Ets Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ELK3 Ets Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ELK4 Ets Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ERF Ets Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ERG Ets Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ETS1 Ets Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ETS2 Ets Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ETV1 Ets Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ETV2 Ets Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ETV3 Ets Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ETV3L Ets Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
ETV4 Ets Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ETV5 Ets Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ETV6 Ets Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ETV7 Ets Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Experimental low-throughput evidence of DNA-binding and changes in reporter expression (PMID: 11108721)
FEV Ets Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FLI1 Ets Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
GABPA Ets Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SPDEF Ets Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SPI1 Ets Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SPIB Ets Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SPIC Ets Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ELF3 Ets; AT hook Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FLYWCH1 FLYWCH Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Several C. elegans FLYWCH domain proteins bind specific DNA sequences in Y1H and EMSA (PMID: 18794349 and PMID: 15165844).
FOXA1 Forkhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FOXA2 Forkhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FOXA3 Forkhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FOXB1 Forkhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FOXB2 Forkhead Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
FOXC1 Forkhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FOXC2 Forkhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FOXD1 Forkhead Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
FOXD2 Forkhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FOXD3 Forkhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FOXD4 Forkhead Yes Inferred motif 1 Monomer or homomultimer In vivo/Misc source
FOXD4L1 Forkhead Yes Inferred motif 1 Monomer or homomultimer In vivo/Misc source
FOXD4L2 Forkhead No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Only known motifs are from Transfac or HocoMoco - origin is uncertain This ENSEMBL ID has been retired.
FOXD4L3 Forkhead Yes Inferred motif 1 Monomer or homomultimer In vivo/Misc source
FOXD4L4 Forkhead Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
FOXD4L5 Forkhead Yes Inferred motif 1 Monomer or homomultimer In vivo/Misc source
FOXD4L6 Forkhead Yes Inferred motif 1 Monomer or homomultimer In vivo/Misc source
FOXE1 Forkhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FOXE3 Forkhead Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
FOXF1 Forkhead Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
FOXF2 Forkhead Yes Known motif 1 Monomer or homomultimer In vivo/Misc source
FOXG1 Forkhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FOXH1 Forkhead Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Full length protein did not yield an HT-SELEX motif
FOXI1 Forkhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FOXI2 Forkhead Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
FOXI3 Forkhead Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
FOXJ1 Forkhead Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
FOXJ2 Forkhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FOXJ3 Forkhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FOXK1 Forkhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FOXK2 Forkhead Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
FOXL1 Forkhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FOXL2 Forkhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FOXM1 Forkhead Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
FOXN1 Forkhead Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
FOXN2 Forkhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FOXN3 Forkhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FOXN4 Forkhead Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
FOXO1 Forkhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FOXO3 Forkhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FOXO4 Forkhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FOXO6 Forkhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FOXP1 Forkhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Has a putative AT-hook
FOXP2 Forkhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FOXP3 Forkhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FOXP4 Forkhead Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
FOXQ1 Forkhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FOXR1 Forkhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FOXR2 Forkhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
FOXS1 Forkhead Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
ZFYVE26 FYVE-type ZF No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif FYVE zinc fingers are unlikely to bind DNA
GATA1 GATA Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
GATA2 GATA Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
GATA3 GATA Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
GATA4 GATA Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
GATA5 GATA Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
GATA6 GATA Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
GATAD1 GATA No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif The GATA domain is truncated (see alignment)
GATAD2A GATA Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has the full GATA domain, and JPRED4 thinks the secondary structure is preserved. The GATA domain is not sufficiently well studied to declare that specific amino acids are absolutely required in order to bind DNA. Many unusual GATA domain proteins across eukaryotes bind DNA, making it reasonable to project that this one does, too.
GATAD2B GATA Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has the full GATA domain, and JPRED4 thinks the secondary structure is preserved. The GATA domain is not sufficiently well studied to declare that specific amino acids are absolutely required in order to bind DNA. Many unusual GATA domain proteins across eukaryotes bind DNA, making it reasonable to project that this one does, too.
TRPS1 GATA Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
ZGLP1 GATA Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
GCM1 GCM Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
GCM2 GCM Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
GRHL1 Grainyhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
GRHL2 Grainyhead Yes Known motif 1 Monomer or homomultimer In vivo/Misc source
GRHL3 Grainyhead Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Binds the same AACCGGTT consensus as the paralog GRHL1 based on SELEX (PMID: 21081122).
TFCP2 Grainyhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TFCP2L1 Grainyhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
UBP1 Grainyhead Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
GTF2I GTF2I-like Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain (PMID: 18326499) shows through SELEX and EMSA that this family binds DNA specifically. Transfac motifs are dubious.
GTF2IRD1 GTF2I-like Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain (PMID: 18326499) shows through SELEX and EMSA that this family binds DNA specifically. Transfac motifs are dubious. V$BEN_02 motif has partial similarity to a shift-experiment sequence (PMID:14645227), which shows DNA-binding and evidence of transcriptional regulation by knockdown experiments
GTF2IRD2 GTF2I-like Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif (PMID: 18326499) shows through SELEX and EMSA that this family binds DNA specifically.
GTF2IRD2B GTF2I-like Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif (PMID: 18326499) shows through SELEX and EMSA that this family binds DNA specifically.
AC105001.2 HMG/Sox No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Unlikely to be sequence specific TF - it has a deletion inside the SOX-domain removing several residues that contact DNA based on the structure of paralog SOX17.
BBX HMG/Sox Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
CCDC124 HMG/Sox No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Based on the alignment, it lacks a proper HMG domain. Evidence it binds RNA (PMID: 22658674).
CHD3 HMG/Sox No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Has a putative AT-hook No evidence for sequence-specific DNA-binding in the literature; and contains only a partial match to an HMG box with no similarity to DBDs of other CHD family proteins
CHD4 HMG/Sox No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif CHD4 is likely not a sequence-specific DNA-binding protein despite having a partial match to an HMG box. This protein binds to the DNA backbone, but binds poly(ADP-ribose) with higher affinity (PMID: 26565020).
CIC HMG/Sox Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
HBP1 HMG/Sox Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
HMG20A HMG/Sox Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Similar to HMG20B, which has an inferred motif from mouse.
HMG20B HMG/Sox Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
HMGB1 HMG/Sox No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif In the alignment, it clusters with other HMG proteins that have not yielded motifs. Evidence exists showing HMGB1/2 are non-sequence-specific binding proteins (PMID: 11497996).
HMGB2 HMG/Sox No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif In the alignment, it clusters with other HMG proteins that have not yielded motifs. Evidence exists showing HMGB1/2 are non-sequence-specific binding proteins (PMID: 11497996). HMGB2 is well-known to facilitate DNA-bending and interact with sequence-specific TFs and transcriptional co-factors.
HMGB3 HMG/Sox No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Similar to HMGB1/2, which bind DNA with low specificity
HMGB4 HMG/Sox No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Similar to HMGB1/2, which bind DNA with low specificity. Yet, it can also bind with 4.35nM affinity to DNA containing an intra-strand crosslink made by cis-platin (PMID: 22901013).
HMGN1 HMG/Sox No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif In the alignment, it clusters with other HMG proteins that have not yielded motifs.
HMGN3 HMG/Sox Yes Likely to be sequence specific TF 3 Low specificity DNA-binding protein No motif
HMGXB3 HMG/Sox No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif In the alignment, it clusters with other HMG proteins that have not yielded motifs.
HMGXB4 HMG/Sox No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif In the alignment, it clusters with other HMG proteins that have not yielded motifs.
KMT2C HMG/Sox No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Has a putative AT-hook Based on the alignment, it is quite different from all other HMG proteins. It is borderline to say that it is a HMG at all.
KMT2D HMG/Sox No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Based on alignment it is quite different from all other HMG proteins, borderline to say if it is a HMG at all. Crystal structure has an aminoacid sequence that doesnt match to the protein it claims to be
LEF1 HMG/Sox Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
MAEL HMG/Sox No ssDNA/RNA binding 4 Not a DNA binding protein No motif Orthologous protein from mouse binds RNA (PMID: 25807393)
NSD2 HMG/Sox No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Likely affects transcription by histone modification (not specific DNA-binding).
PBRM1 HMG/Sox No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif (PMID: 23867514) shows it may bind nucleosomal DNA.
PMS1 HMG/Sox No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif In the alignment, it clusters with other HMG proteins that have not yielded motifs.
SMARCE1 HMG/Sox No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif In the alignment, it clusters with other HMG proteins that have not yielded motifs. Contributes to SWI/SNF DNA-binding (PMID: 9435219).
SOX1 HMG/Sox Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
SOX10 HMG/Sox Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SOX11 HMG/Sox Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
SOX12 HMG/Sox Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SOX13 HMG/Sox Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
SOX14 HMG/Sox Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SOX15 HMG/Sox Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SOX17 HMG/Sox Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SOX18 HMG/Sox Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SOX2 HMG/Sox Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SOX21 HMG/Sox Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SOX3 HMG/Sox Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SOX30 HMG/Sox Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SOX4 HMG/Sox Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Also binds ssDNA loops.
SOX5 HMG/Sox Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SOX6 HMG/Sox Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SOX7 HMG/Sox Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SOX8 HMG/Sox Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SOX9 HMG/Sox Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Also binds ssDNA loops.
SRY HMG/Sox Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SSRP1 HMG/Sox No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif HMG domain is highly divergent based on AA-sequence
TCF7 HMG/Sox Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TCF7L1 HMG/Sox Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TCF7L2 HMG/Sox Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
TFAM HMG/Sox No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif HMG domain is highly divergent based on AA-sequence
TOX HMG/Sox No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Predicted to be a non- or low specificity TF (PMID: 12697058). However, there is a DAM-id based motif with SSSSGNNGCG-consensus (PMID: 25527292), but this does not look like HMG-site
TOX2 HMG/Sox No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif TOX proteins are clearly their own distinct subfamily of HMG proteins. No strong evidence for them binding DNA specifically.
TOX3 HMG/Sox No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif TOX proteins are clearly their own distinct subfamily of HMG proteins. No strong evidence for them binding DNA specifically.
TOX4 HMG/Sox No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif TOX proteins are clearly their own distinct subfamily of HMG proteins. No strong evidence for them binding DNA specifically.
UBTF HMG/Sox No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif No evidence for or against specific DNA-binding by this class of HMG box containing proteins
UBTFL1 HMG/Sox No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif No evidence for or against specific DNA-binding by this class of HMG box containing proteins
WDHD1 HMG/Sox No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Divergent HMG motif, doesnt cluster either with specific or nonspecific HMG proteins
BHMG1 HMG/Sox; bHLH No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Based on the alignment, it lacks a proper HMG domain. bHLH domain is also highly unlike any other human bHLH TF (<40% DBD ID)
ADNP Homeodomain Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ADNP2 Homeodomain Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ALX1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ALX3 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ALX4 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ANHX Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ARGFX Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ARX Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
BARHL1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
BARHL2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
BARX1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Has a putative AT-hook
BARX2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Has a putative AT-hook
BSX Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
CDX1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
CDX2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
CDX4 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
CERS2 Homeodomain No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Unlikely to be a TF - homeodomain is heavily truncated at the N-terminus; and LASS2/CERS2 has previously been shown to be involved in ceramide synthesis (PMID:20937905).
CERS3 Homeodomain No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Unlikely to be a TF - homeodomain is heavily truncated at the N-terminus; and LASS2/CERS2 has previously been shown to be involved in ceramide synthesis (PMID:20937905).
CERS4 Homeodomain No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Unlikely to be a TF - homeodomain is heavily truncated at the N-terminus; and LASS2/CERS2 has previously been shown to be involved in ceramide synthesis (PMID:20937905).
CERS5 Homeodomain No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Unlikely to be a TF - homeodomain is heavily truncated at the N-terminus; and LASS2/CERS2 has previously been shown to be involved in ceramide synthesis (PMID:20937905).
CERS6 Homeodomain No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Unlikely to be a TF - homeodomain is heavily truncated at the N-terminus; and LASS2/CERS2 has previously been shown to be involved in ceramide synthesis (PMID:20937905).
CRX Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
DBX1 Homeodomain Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
DBX2 Homeodomain Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
DLX1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
DLX2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
DLX3 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
DLX4 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
DLX5 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
DLX6 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
DMBX1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
DPRX Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
DRGX Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
DUX1 Homeodomain Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Not included in Ensembl. Binds GATCTGAGTCTAATTGAGAATTACTGTAC in EMSA (PMID: 9736770)
DUX3 Homeodomain Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Not included in Ensembl.
DUX4 Homeodomain Yes Known motif 1 Monomer or homomultimer In vivo/Misc source
DUXA Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
EMX1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
EMX2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
EN1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
EN2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ESX1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
EVX1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
EVX2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
GBX1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
GBX2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
GSC Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
GSC2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
GSX1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
GSX2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HDX Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HESX1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HHEX Homeodomain Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
HLX Homeodomain Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
HMBOX1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HMX1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HMX2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HMX3 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HNF1A Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HNF1B Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOMEZ Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOPX Homeodomain No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Lacks conserved residues required for DNA binding (PMID: 24287901)
HOXA1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXA10 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXA11 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Also forms heterodimers with MEIS and PBX.
HOXA13 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXA2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXA3 Homeodomain Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
HOXA4 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Has a putative AT-hook
HOXA5 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXA6 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXA7 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXA9 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXB1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXB13 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Also forms heterodimers.
HOXB2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXB3 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXB4 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXB5 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXB6 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXB7 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXB8 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXB9 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXC10 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXC11 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXC12 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXC13 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXC4 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXC5 Homeodomain Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
HOXC6 Homeodomain Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
HOXC8 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXC9 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXD1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXD10 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXD11 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXD12 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXD13 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXD3 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXD4 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXD8 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HOXD9 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
IRX1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Has a putative AT-hook
IRX2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
IRX3 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
IRX4 Homeodomain Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
IRX5 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
IRX6 Homeodomain Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
ISL1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ISL2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ISX Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
LBX1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
LBX2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
LEUTX Homeodomain Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
LHX1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
LHX2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Has a putative AT-hook
LHX3 Homeodomain Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
LHX4 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
LHX5 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
LHX6 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
LHX8 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
LHX9 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Has a putative AT-hook
LMX1A Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
LMX1B Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
MEIS1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
MEIS2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
MEIS3 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
MEOX1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
MEOX2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
MIXL1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
MKX Homeodomain Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Orthologous protein from fly is a TF that binds NWACA (PMID: 22923612).
MNX1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
MSX1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
MSX2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NANOG Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NANOGNB Homeodomain Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
NANOGP8 Homeodomain Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro Listed as a pseudogene, but it encodes two protein products
NKX1-1 Homeodomain Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
NKX1-2 Homeodomain Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
NKX2-1 Homeodomain Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
NKX2-2 Homeodomain Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
NKX2-3 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NKX2-4 Homeodomain Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
NKX2-5 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NKX2-6 Homeodomain Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
NKX2-8 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NKX3-1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NKX3-2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NKX6-1 Homeodomain Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
NKX6-2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Has a putative AT-hook
NKX6-3 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NOBOX Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NOTO Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
OTP Homeodomain Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
OTX1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
OTX2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PBX1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PBX2 Homeodomain Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain High sequence similarity to PBX1, PBX4, and drosophila exd, which have in vitro-derived motifs
PBX3 Homeodomain Yes Known motif 1 Monomer or homomultimer In vivo/Misc source High sequence similarity to PBX1, PBX4, and drosophila exd, which have in vitro-derived motifs
PBX4 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PDX1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PHOX2A Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PHOX2B Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PITX1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PITX2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PITX3 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PKNOX1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PKNOX2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PROP1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PRRX1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PRRX2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
RAX Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
RAX2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
RHOXF1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
RHOXF2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
RHOXF2B Homeodomain Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
SEBOX Homeodomain Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro Role in early development (PMID: 24018616).
SHOX Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SHOX2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SIX1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SIX2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SIX3 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SIX4 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SIX5 Homeodomain Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
SIX6 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TGIF1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TGIF2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TGIF2LX Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TGIF2LY Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TLX1 Homeodomain Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
TLX2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TLX3 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TPRX1 Homeodomain Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Expressed in early embryo as transcripts that contain a full homeodomain (PMID: 27412763).
UNCX Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
VAX1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
VAX2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
VENTX Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
VSX1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
VSX2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZFHX2 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ZHX1 Homeodomain Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Has a putative AT-hook
ZHX2 Homeodomain Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
ZHX3 Homeodomain Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
PAX2 Homeodomain; Paired box Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PAX3 Homeodomain; Paired box Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PAX4 Homeodomain; Paired box Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PAX6 Homeodomain; Paired box Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PAX7 Homeodomain; Paired box Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
POU1F1 Homeodomain; POU Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
POU2F1 Homeodomain; POU Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
POU2F2 Homeodomain; POU Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
POU2F3 Homeodomain; POU Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
POU3F1 Homeodomain; POU Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
POU3F2 Homeodomain; POU Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
POU3F3 Homeodomain; POU Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
POU3F4 Homeodomain; POU Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
POU4F1 Homeodomain; POU Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
POU4F2 Homeodomain; POU Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
POU4F3 Homeodomain; POU Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
POU5F1 Homeodomain; POU Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
POU5F1B Homeodomain; POU Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
POU5F2 Homeodomain; POU Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
POU6F1 Homeodomain; POU Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
POU6F2 Homeodomain; POU Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HSF1 HSF Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HSF2 HSF Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HSF4 HSF Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HSF5 HSF Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HSFX1 HSF Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
HSFX2 HSF Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
HSFY1 HSF Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HSFY2 HSF Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
IRF1 IRF Yes Known motif 1 Monomer or homomultimer In vivo/Misc source
IRF2 IRF Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
IRF3 IRF Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
IRF4 IRF Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
IRF5 IRF Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Has a putative AT-hook
IRF6 IRF Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
IRF7 IRF Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
IRF8 IRF Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
IRF9 IRF Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
LYAR LYAR-type C2H2 ZF No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif LYAR-type C2H2 ZF domains have not been shown to bind DNA. LYAR binds to the 60S subunit of the ribosome. It regulates translation rather than transcription (PMID: 24990247).
MSANTD1 MADF Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
MSANTD3 MADF Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NAIF1 MADF Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
BORCS8-MEF2B MADS box Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
MEF2A MADS box Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
MEF2B MADS box Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
MEF2C MADS box Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
MEF2D MADS box Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SRF MADS box Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
BAZ2B MBD Yes Likely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Has a putative AT-hook
MBD2 MBD Yes Known motif 3 Low specificity DNA-binding protein In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain; Has a putative AT-hook
MBD3 MBD Yes Likely to be sequence specific TF 3 Low specificity DNA-binding protein No motif The MBD domain of MBD3 is thought to be primarily responsible for interaction with HDAC1 and MTA2, members of the NuRD complex (PMID: 12124384). More recently, studies have shown that it retains the ability to bind methylated CpG sites in vitro (PMID: 24307175) with lower affinity than other MBD proteins (e.g., MBD2), but does not distinguish between hydroxymethylated and unmethylated sites. Coupled with in vivo ChIP experiments, it appears that MBD3 binds unmethylated CpG sites in vivo after be
MBD4 MBD Yes Likely to be sequence specific TF 3 Low specificity DNA-binding protein No motif
MBD6 MBD Yes Likely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Has not been tested on PBM or HT-SELEX. Some evidence exists showing that it does not bind methylated DNA (PMID: 20700456), and the MBD domain instead facilitates protein interactions (PMID: 24634419).
PIN1 MBD Yes Likely to be sequence specific TF 3 Low specificity DNA-binding protein No motif
SETDB1 MBD Yes Known motif 3 Low specificity DNA-binding protein In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Transfac motif is dubious.
SETDB2 MBD Yes Likely to be sequence specific TF 3 Low specificity DNA-binding protein No motif
BAZ2A MBD; AT hook Yes Likely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Component of the silencing nucleolar remodelling complex (NoRC) (PMID: 22368283)
MECP2 MBD; AT hook Yes Known motif 3 Low specificity DNA-binding protein 100 perc ID - in vitro Binds methylated CpG dinucleotides (PDB: 3C2I)
MBD1 MBD; CxxC ZF Yes Likely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Binds CpG methylated DNA (PDB: 1IG4). It is unclear how much other specificity has been defined.
MTERF1 mTERF Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain The structure (PDB: 3MVA) shows a large protein DNA-interaction interface.
MTERF2 mTERF Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
MTERF3 mTERF Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Crystral structure available (PMID: 20430012)
MTERF4 mTERF Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif MTERF4 can bind RNA (PMID: 22949673), but likely to also bind DNA like other mTERF family members.
NEB mTERF No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Gene Cards/GO indicates that NEB is not present in the nucleus; and it appears to be an actin binding protein highly expressed in muscle.
C17orf49 Myb/SANT No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Contains 1 SANT domain, suggesting it cannot bind DNA specifically
CDC5L Myb/SANT Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Compelling evidence for DNA binding (PMID: 11082045).
CHD2 Myb/SANT No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Only known motifs are from Transfac or HocoMoco - origin is uncertain; Has a putative AT-hook Although CHD2 has weak similarity to a Myb domain (PMID: 9326634), its more closely related to the non-DNA-binding SANT domain based on the alignment analysis. The data showing that show that CHD2 binding histone H3.3 (PMID:22569126) further support the conclusion that the Myb domain is probably a SANT domain facilitating the histone interaction
CRAMP1 Myb/SANT No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Contains a single SANT domain, no evidence for sequence-specific DNA binding
DMTF1 Myb/SANT Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Contains 2 Myb DBDs. Binds to CCCG(G/T)ATGT (PMID: 8887674)
DNAJC1 Myb/SANT No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Contains 2 SANT domains, and no other putative DNA-binding domains
DNAJC2 Myb/SANT No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Contains 2 SANT domains, and no other putative DNA-binding domains
ELMSAN1 Myb/SANT No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Contains a single SANT domain, no evidence for sequence-specific DNA binding
KIAA1841 Myb/SANT No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Domain is truncated, and there is nothing known about this gene
MIER1 Myb/SANT No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Contains a single SANT domain, no evidence for sequence-specific DNA binding
MIER2 Myb/SANT No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a putative AT-hook MIER2s Myb domain is more similar to the non-DNA-binding SANT domain
MIER3 Myb/SANT No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif MIER3s Myb domain is more similar to the non-DNA-binding SANT domain. Tested on both PBM and HT-SELEX, with no motif.
MIS18BP1 Myb/SANT No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Contains 1 SANT domain, and a SANTA domain
MSANTD4 Myb/SANT Yes Likely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Contains a single Myb-like domain with an insertion in the middle. It is ambiguous whether Myb-like domains are DNA or protein binding. Since it has a single domain its likely non-specific.
MYB Myb/SANT Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Contains 3 Myb DBDs
MYBL1 Myb/SANT Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Contains 3 Myb DBDs
MYBL2 Myb/SANT Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Contains 3 Myb DBDs
MYPOP Myb/SANT Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Contains a single Myb-like domain. Mouse ortholog has motif
MYSM1 Myb/SANT Yes Likely to be sequence specific TF 3 Low specificity DNA-binding protein No motif MYSM1 has been shown to bind DNA. This interaction requires the MYSM1 Myb but not the SWIRM domain (PMID: 17428495). Domain sequence alignment places it near DNA-binding Myb domains but scores slightly higher as a SANT rather than Myb domain based on Prosite patterns. Given that most Myb proteins that bind DNA sequence specifically have multiple Myb domains in an array, this protein could bind DNA sequence non-specifically with its single Myb domain.
NCOR1 Myb/SANT No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Contains 2 SANT domains, and no other putative DNA-binding domains. Member of N-CoR deacetylase complex (PMID: 14527417).
NCOR2 Myb/SANT No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Contains 2 SANT domains, and no other putative DNA-binding domains
PRDM11 Myb/SANT No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif SANT domain containing protein. Mouse Prdm11 contains Myb-like domain and binds DNA in PBM experiments but has low sequence identity (21%)
RCOR1 Myb/SANT No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Contains 2 SANT domains, and no other putative DNA-binding domains. Plays a well-established co-repressor role in the histone LSD1/RCOR1 de-methylase complex. There is some evidence that the protein contacts extranucleosomal DNA (PMID: 25916846).
RCOR2 Myb/SANT No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Contains 2 SANT domains, and no other putative DNA-binding domains
RCOR3 Myb/SANT No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Contains 2 SANT domains, and no other putative DNA-binding domains. RCOR3 SANT domains are known to facilitate PPIs. Known co-repressor - likely recruited by multiple TFs, as reviewed in (PMID: 24820421).
SMARCA1 Myb/SANT No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif SMARCA1 contains a truncated Myb-like and SANT domain. Given the presence of the Myb-like domain, and other domains known to associated with DNA (DEAD box helicase) it likely associates with DNA non-sequence-specifically
SMARCA5 Myb/SANT No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Has a putative AT-hook Contains a SANT, and Myb-like domain. Chromatin remodeling complex component that operates in DNA repair (PMID: 24990377); interacts with DNA, but presumably in non-sequence specific manner.
SMARCC1 Myb/SANT No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Contains 1 SANT domain, and no other putative DNA-binding domains. Given that SMARCC1 is part of the Swi/Snf chromatin remodelling complex, its Myb/Sant domain is likely involved in binding histone tails. Available motif logos ares likely specificifities of SMARCC1 interactors.
SMARCC2 Myb/SANT No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Contains 1 SANT domain, and no other putative DNA-binding domains. Available motif logos ares likely specificifities of SMARCC2 interactors.
SNAPC4 Myb/SANT Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif EMSA data available showing it can specifically bind DNA (PMID: 9418884)
TADA2A Myb/SANT No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif TADA2A contains a single SANT domain and is thus unlikely to bind DNA
TADA2B Myb/SANT No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif TADA2B contains a single SANT domain and is thus unlikely to bind DNA
TERB1 Myb/SANT Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Contains a single Myb domain (with slightly less similarity to a SANT domain). This domain has been shown to be involved in PPIs (PMID: 24413433), but this may not be mutually exclusive with DNA-binding.
TERF1 Myb/SANT Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Contains 1 Myb domain, and has structural evidence of DNA-binding (PDB: 1IV6). Subunit of Shelterin, a complex that specifically binds telomeres (PMID: 16166375).
TERF2 Myb/SANT Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro The sequence in the crystal structure (PDB:1VFC), GTTAGGGTTAGGG, matches the inferred mouse motif.
TERF2IP Myb/SANT No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Contains a single Myb-like domain. Forms a complex with TERF2, where it modulates the binding of TERF2 to telomeres (PMID: 25675958). Unclear if TERF2IP contacts DNA directly.
TTF1 Myb/SANT Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Contains Myb and Myb-like domains, and is annotated as a Pol1 terminator. DNA-binding has been demonstrated in vitro via EMSA (PMID: 7597036).
ZZZ3 Myb/SANT Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Contains 1 Myb DBD
MTA1 Myb/SANT; GATA No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Contains a GATA and SANT domain. Unclear whether the GATA domain is a bona fide DBD as the MTA/RERE family domains are atypical to human GATA domains (see alignment). In CIS-BP there is one protein from C.elegans that shares domain homology and binds a GATA motif (elg-27, ChIP-seq). The GATA ZnF domain of MTA1 is required for its interaction with RBBP4 and RBBP7 (PMID:18067919). Full-length protein has been tried in HT-SELEX and did not yield a motif
MTA2 Myb/SANT; GATA No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Contains a GATA and SANT domain. Unclear whether the GATA domain is a bona fide DBD as the MTA/RERE family domains are atypical to human GATA domains (see alignment). In CIS-BP there is one protein from C.elegans that shares domain homology and binds a GATA motif (elg-27, ChIP-seq). Full-length protein has been tried in HT-SELEX, and DBD has been tried on PBM - neither yielded motifs
MTA3 Myb/SANT; GATA No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Contains a GATA and SANT domain. Unclear whether the GATA domain is a bona fide DBD as the MTA/RERE family domains are atypical to human GATA domains (see alignment). In CIS-BP there is one protein from C.elegans that shares domain homology and binds a GATA motif (elg-27, ChIP-seq). Hasnt been tried in any in vitro assays
RERE Myb/SANT; GATA No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Contains a GATA and SANT domain. Unclear whether the GATA domain is a bona fide DBD as the MTA/RERE family domains are atypical to human GATA domains (see alignment). In CIS-BP there is one protein from C.elegans that shares domain homology and binds a GATA motif (elg-27, ChIP-seq). Has been tried as a DBD in HT-SELEX but did not yield a motif
ZMYM1 MYM-type ZF No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
ZMYM2 MYM-type ZF No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
ZMYM3 MYM-type ZF No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif The cassette of seven znf-MYM domains are used to bind SUMO (PMID: 25133527). Overall, very little is known about this domain or protein.
ZMYM4 MYM-type ZF No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Lacks a canonical DBD
ZMYM5 MYM-type ZF No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Binds to and represses activity of ETV5 based on (PMID: 17126306), but there is no evidence for it binding the DNA itself, so it seems like an co-repressor
ZMYM6 MYM-type ZF No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Truncated BED ZF
ZMYND10 MYND-type ZF No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
MYRF Ndt80/PhoG Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Mouse ortholog binds a highly similar motif.
MYRFL Ndt80/PhoG Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Related to other MYRF TFs, which have related PBM motifs
NFX1 NFX Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
NFXL1 NFX Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Likely a TF based on presence of NFX ZF.
ZNF330 NOA36-type ZF No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein has IPR010531 domain, Zinc finger protein NOA36, which has not been shown to bind DNA
AR Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ESR1 Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ESR2 Nuclear receptor Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
ESRRA Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ESRRB Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
ESRRG Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HNF4A Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
HNF4G Nuclear receptor Yes Known motif 1 Monomer or homomultimer In vivo/Misc source
NR0B1 Unknown Yes Known motif 2 Obligate heteromer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
NR1D1 Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NR1D2 Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NR1H2 Nuclear receptor Yes Known motif 2 Obligate heteromer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Likely an obligate heteromer (PMID: 7935418; PMID: 7892230; PMID: 7744246)
NR1H3 Nuclear receptor Yes Inferred motif 2 Obligate heteromer In vivo/Misc source Binds as an obligate heterodimer with RXR-proteins. (PDB: 2ACL) is a crystal structure of the two proteins without DNA
NR1H4 Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Also binds DNA as heterodimer with RXRA (PMID: 11870371)
NR1I2 Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NR1I3 Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NR2C1 Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NR2C2 Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NR2E1 Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NR2E3 Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NR2F1 Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NR2F2 Nuclear receptor Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
NR2F6 Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NR3C1 Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NR3C2 Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NR4A1 Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NR4A2 Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NR4A3 Nuclear receptor Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
NR5A1 Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NR5A2 Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NR6A1 Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PGR Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PPARA Nuclear receptor Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
PPARD Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PPARG Nuclear receptor Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro Also heterodimerizes.
RARA Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
RARB Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
RARG Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
RORA Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
RORB Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
RORC Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
RXRA Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
RXRB Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Has been shown to bind both as a homodimer and with several nuclear receptor homodimerization partners
RXRG Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Usually binds in vivo as a heterodimer, but can bind as a homodimer in vitro
THRA Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Likely binds as a heterodimer too
THRB Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
VDR Nuclear receptor Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
AATF Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Likely does not bind to bind to DNA (PMID: 17634135).
ABL1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
ABRA Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif The Costars domain in this protein is an atypical winged helix protein that does not bind DNA but to other proteins (PMID: 21082705)
AC020915.1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
ACOD1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
ACTR3B Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
ACTR3C Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Pfam match to an APSES domain - this is likely a false positive, as these domains are mostly present in bacteria and fungi
ADAM8 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
ADAMTS17 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
ADAMTS19 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a putative AT-hook
ADAR Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif PMID: 21728134 shows the ADAR protein bind to ds RNA and Z DNA. At best it would be a non-sequence specific DNA binding protein. But, it has a well established role as a dsRNA binding protein, so it is unlikely to be a TF.
ADGRA1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
ADGRG3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
AEBP1 Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif This is a protease, but its ability to bind DNA is supported by both gel-shift (PMID: 15654748) and ChIP (PMID: 22723309).
AES Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Likely a transcriptional co-factor
AFAP1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif There is no evidence suggesting DNA-binding activity
AFF1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a putative AT-hook MLL fusion partner
AFF3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif (PMID: 8555498) only says that In vitro-translated LAF-4 was able to bind strongly to double-stranded DNA cellulose - thats more consistent with nonspecific DNA binding. The key issue is whether the Transcription factor AF4/FMR2 (IPR007797) domain really is sequence specific. Most of the work has been done on the one Drosophila ortholog, lilliuputian. I see no evidence of DNA binding. Recent work on this family in human indicate that it functions in coactivation (PMID: 27899651; PMID: 261712
AFF4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif (PMID: 8555498) only says that In vitro-translated LAF-4 was able to bind strongly to double-stranded DNA cellulose - thats more consistent with nonspecific DNA binding. The key issue is whether the Transcription factor AF4/FMR2 (IPR007797) domain really is sequence specific. Most of the work has been done on the one Drosophila ortholog, lilliuputian. I see no evidence of DNA binding. Recent work on this family in human indicate that it functions in coactivation (PMID: 27899651; PMID: 261712
AGER Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Contacts DNA in the structure (PDB: 4OI7)
AGT Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
AIM2 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Based on (PDB: 3RN2), the protein binds DNA but contacts only the backbone; AIM2 binds cytrosolic dsDNA in the innate immune response
AKT1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
ALK Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Operates far upstream in the signaling cascade
ALKBH2 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Dioxygenase that repairs alkylated DNA and RNA containing 1-methyladenine and 3-methylcytosine by oxidative demethylation. Binds DNA in the crystal structure (PDB: 3BTX)
AMH Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
ANAPC2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Scaffolding protein that associates with ubiquitin ligase complexes
ANKRD30A Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a putative AT-hook GO citation (PMID: 11280766) has no evidence of DNA-binding activity and was based on homology
ANXA3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein operates far upstream on the signaling cascade.
ANXA4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
AP5Z1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif May have helicase activity and play a role in DNA repair (PMID: 20613862)
APBB3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
APEX1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif The structure (PDB:1DEW) is with abasic DNA - the protein is a base excision repair enzyme that cleaves off abasic bases
APOBEC3A Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Binds ssDNA (PDB: 5KEG)
APOBEC3B Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Binds ssDNA (PDB: 5TD5)
APOBEC3G Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Restriction factor of HIV-1 that binds ssDNA (PDB: 5K83)
APTX Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Binds and fixes DNA-RNA hybrids/ APTX efficiently repairs adenylated RNA-DNA and acts in the RNA-DNA damage response (PMID: 24362567)
ARHGAP35 Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Binds DNA specifically based on EMSA and nuclease protection assay data (PMID: 1894621), despite lacking any clear DBDs.
ARHGEF2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
ARHGEF5 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif GO annotation provides no evidence of DNA-binding activity (PMID: 15601624)
ARRB1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif ChIP data available, but unclear if it can bind to DNA directly (PMID: 16325578)
ARRB2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
ASCC1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a coactivator that is reported to bind to SRF, NFKB1, and JUN (PMID: 12077347)
ATF7IP Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Murine homolog involved in H4K9 trimethylation by SETDB1 (PMID: 14536086)
ATM Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Kinase protein that binds to and activates certain TFs
ATR Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif
ATRX Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif ATRX does not contain any canonical sequence-specific DBDs but it does contain a non-specific DNA binding helicase that allows it to bind repeat sequences (PMID:21029860) and telomeres (PMID:20651253). ATRX is involved in multiple processes (transcription, replication), and is associated with multiple complexes (Swi/Snf, histone chaperones, and repressive complexes including TRIM 28 (PMID:27029610)), and as such does affect transcription. Given the lack of sequence-specific binding it is unlikel
ATXN7 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif ATXN7 SCA7 domain facilitates interactions with histone dimers (PMID: 20634802)
BAG1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Antiapoptotic BCL-protein
BANF1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Binds DNA in the crystal structure, contacting only the backbone from the side of the minor groove (PDB: 2BZF)
BANP Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Only known motifs are from Transfac or HocoMoco - origin is uncertain BANP has no DBD and is known to bind other TFs; likely that the Transfac motif is from one of its binding partners
BCL10 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Apoptosis associated protein that operates upstream on a cascade that includes NFKB
BCL3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Only known motifs are from Transfac or HocoMoco - origin is uncertain No DBD - instead, this is a known cofactor of NF-kappaB. The Transfac motif is the NFKB1 motif. GO cites only electronic annotation and needs to be fixed.
BCLAF1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain No DBD. Only weak evidence is available for indirect binding (PMID: 10330179). Suspect motif - it is a clear ETS-site. (PMID: 10330179) shows that the protein binds DNA in filter binding assay, but not that it is sequence specific.
BCOR Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Transcriptional co-repressor that associates with BCL6 (PMID: 10898795)
BDP1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
BEX1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Likely a cofactor- (PMID: 16314316) shows results for related BEX2
BIN1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
BLM Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Helicase involved in DNA replication and repair (PDB: 4CGZ)
BLZF1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif This is a golgi protein with no evidence for DNA binding.
BMI1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif BMI1 binds to nucleosomes as part of the PRC1 complex but does not contact the DNA directly (PDB: 4R8P)
BMP2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
BMP4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Likely a cofactor.
BMP7 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
BMPR1A Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
BOD1L1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a putative AT-hook
BOLA1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
BOLA2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
BOLA2B Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
BOLA3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif E. Coli homologue of the BOLA binds DNA; however there is no evidence in the mammalian proteins
BPNT1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
BPTF Unknown Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain; Has a putative AT-hook (PMID: 10575013) obtained a motif by SELEX and showed that mutating the sequence diminished binding in vitro. Unusual for a PHD/Ring finger, but its there in the literature.
BRCA1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein In vivo/Misc source BRCA1 likely binds to DNA without DNA sequence specificity (PMID: 11353843)
BRD4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Binds acetylated histones
BRD7 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
BRD8 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a putative AT-hook TF-coactivator
BRD9 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Evidence ony for interaction with histones (PMID: 22464331)
BRF1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Only known motifs are from Transfac or HocoMoco - origin is uncertain GTF - Pol III - TRANSFAC has a motif but its likely not for this protein, but for the complex as a whole
BRF2 Unknown Yes Likely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Makes backbone and sequence-specific interactions with DNA (PDB: 4ROC), but only involved in recognizing dinucleotides flanking the TATA box (PMID: 26638071). Redox sensing determines activation and repression of target genes
BRMS1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif BRMS1 functions as a corepressor by promoting binding of HDAC1 to RelA/p65, where it deacetylates lysine K310 on RelA/p65, which suppresses RelA/p65 transcriptional activity (PMID: 17000776)
BRPF1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a putative AT-hook
BTAF1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Protein that uses ATP to dissociate TBP from the promoter
BTBD8 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Probably annotated as TF based on presence of a BTB domain; however, these domains are not known to bind DNA
BTG2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Transcriptional co-factor (PMID: 10617598)
BTK Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Involved in the regulation of ARID3A and NFAT in B lymphocyte development; has been thoroughly investigated, but there is no evidence to demonstrate DNA binding activity (see UniProt Q06187)
BTRC Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
BUD31 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Included because GO says its DNA binding on the basis of (PMID: 7841202), a 1995 paper that only suggests DNA binding on the basis of the protein sequence. In fact, it is composed entirely of a G10 domain.
C14orf39 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
C1D Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif C1D has been shown to bind RNA (PMID: 17412707) and is associated with the exosome. C1D is also associated with DNA repair and has DNA-binding activitiy (PMID: 10362552)
C20orf194 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
C3orf33 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Some effect on DNA-binding of AP-1 (PMID: 20680465), but does no data supporting a role for C3orf33 as a DNA-binding factor itself
CACTIN Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein operates on a signaling cascade far upstream of NFKB (PMID: 20829348)
CAMK1D Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Functions in signalling cascade that leads to phosphorylation and activation of CREB (PMID: 16324104)
CAMK2A Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
CAPN15 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Basically an unknown protein - a likely protease that contains also znfRANBP-domains, so it could be a RNA-binding protein
CAPN3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Included only because GO says positive regulation of NF-kappaB transcription factor activity. No indication of sequence specific DNA binding.
CARD11 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Plasma-membrane protein possibly functioning in upstream signaling of NFKB (PMID: 12154360)
CARD14 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
CARF Unknown Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Transfac-only motif. Major evidence is found in (PMID: 11832226). Cloned by Y1H and binding demonstrated by gel-shift. Mutant probes do not compete. DNA binding ability seems solid but motif is sketchy.
CASP8AP2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Pfam DBD match is a likely false-positive - did not produce a motif in PBM experiments
CAT Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein that breaks down hydrogen peroxide
CBFA2T2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif CBFA2T2 oligomerizes to form a scaffold upon which PRDM14 and OCT4 are stabilized on chromatin (PMID: 27281218)
CBFA2T3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Co-repressor - does not contact DNA (PMID: 12559562; PMID: 15203199)
CBFB Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Only known motifs are from Transfac or HocoMoco - origin is uncertain CBFB augments the binding of RUNX to DNA, but does not itself bind DNA. Thus; it is a cofactor. Reviewed in (PMID:11105900). Two citations used by GO (PMID:8351518; PMID:9751756) do not demonstrate DNA binding.
CBL Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a ubiquitin ligase
CBLL1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif E3-ubiquitin ligase involved in the regulation of cell adhesion (PMID: 11836526)
CC2D1A Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif (PMID: 17714190) states that human Freud-1L bound specifically to its dual repressor element in the 5-HT1A receptor gene in vitro
CC2D1B Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif (PMID: 19423080) says it binds a known locus in vivo, although lack of canonical DBDs suggests indirect DNA-binding
CCDC71 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a putative AT-hook
CCNT1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif General transcription machinery required to stimulate RNA pol II elongation (PMID: 16109377)
CCNT2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Only known motifs are from Transfac or HocoMoco - origin is uncertain Has low or no sequence specificity (PMID: 27899659)
CD36 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
CD40 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Cell surface receptor of TNF-family
CD40LG Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
CDC6 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
CDK5RAP3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
CDK7 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
CDK8 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Mediator component
CDK9 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Kinase protein. There is a structure with RNA (PDB: 5L1Z), where the CDK9 does not contact the RNA
CDKN1A Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
CDKN2A Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein binds to and inactivates NFKB1 (PMID: 10353611)
CEBPZ Unknown Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
CELF3 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Is a well established RBP
CENPA Unknown Yes Likely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Histone like protein. Binds DNA in the crystal structure (PDB: 3AN2).
CENPS Unknown Yes Likely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Binds DNA in the crystal structure (PDB: 4NDY) in heterodimeric complex with CENPX. Protein complex has many contacts with the backbone, but only a few with the bases.
CENPT Unknown Yes Likely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Contains an archaeal histone-like fold (CBF_NFY). but at best would have low sequence specificity. Known role in centromere assembly and lack of known sequence specificity suggest that it is unlikely to be a sequence specific TF.
CENPX Unknown Yes Likely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Binds DNA in the crystal structure (PDB: 4NDY) in heterodimeric complex with CENPS. Protein complex has many contacts with the backbone, but only a few with the bases.
CFLAR Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
CGGBP1 Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Binds unstable triplet repeat 5-d(CGG)n-3 in the human FMR1 gene (PMID: 9201980)
CHCHD3 Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Alias FLJ20420 can specially bind the hBAG-1 promoter region by EMSA and ChIP assays (PMID: 22567091)
CHD1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Has a putative AT-hook (PMID: 22033927) discusses and presents a crystal structure with DNA. The Chd1 chromatin remodeler possesses a C-terminal DNA-binding domain that is required for efficient nucleosome sliding and believed to be essential for sensing the length of DNA flanking the nucleosome core. Recognizes backbone only, so it has low specificity.
CHD6 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif ATP dependent helicase (PMID: 17027977), so it has some affinity for DNA
CHD7 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Helicase and chromodomain
CHD9 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Has a putative AT-hook
CHP1 Unknown No ssDNA/RNA binding 3 Low specificity DNA-binding protein No motif According to EMSA, binds RNA strongly, and dsDNA weakly (PMID: 22727667)
CHRAC1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif
CHUK Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Kinase that operates upstream in the signalling cascade that leads to NFKB
CHURC1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Only known motifs are from Transfac or HocoMoco - origin is uncertain Most recent work has conclusively shown it does not bind DNA (PMID: 17610897), refuting a previous study (PMID: 14651851)
CIB1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
CIITA Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Chromatin modifier
CIR1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
CITED1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Known co-activator. GO says its sequence-specific DNA binding transcription factor activity NAS - PMID: 8901575 but this reference does not show this.
CITED2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
CITED4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Transcriptional co-factor
CIZ1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Presence of zf-C2H2_jaz domain suggests that its likely a dsRNA binding protein
CLU Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Included only because GO says positive regulation of NF-kappaB transcription factor activity, but there is no DBD and no evidence of DNA binding.
CMKLR1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a G protein-coupled receptor for the chemoattractant adipokine chemerin
CNBP Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif CNBP has a specificity for single-stranded DNA (PMID: 2562787)
CNOT3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Only known motifs are from Transfac or HocoMoco - origin is uncertain Part of complex that de-adenylates mRNA molecules (PMID: 27746116)
CNOT4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Regulates transcription through ubiquitination of TFIID (PMID:11823428). Only contains RRM domains, with no DBDs.
CNOT7 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif (PMID:9820826) does not support DNA-binding
CNOT8 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Deadenylase that probably regulates genes post-transcriptionally by controlling mRNA stability (PMID: 19605561)
COMMD1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
COMMD6 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
COMMD7 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
COPS2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
COPS3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Kinase that phosphorylates JUN and possibly other TFs
COPS4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
CPEB1 Unknown Yes Known motif 1 Monomer or homomultimer High-throughput in vitro HT-SELEX motif could be an artefact of ssDNA binding activity, as CPEB1 is a well-characterized RNA-binding protein. Could not find evidence of CPEB1 DNA-binding activity in the literature
CREBBP Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif CREBBP is a likely transcriptional co-activator based on its domains and previous experimental evidence. It has previously been shown to not bind DNA sequence-specifically (PMID: 21539536)
CREG1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Regulates transcription in tethering assays (PMID: 9710587). Unlikely to be a TF, based on the lack of a canonical DBD
CRTC1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
CRTC2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Only known motifs are from Transfac or HocoMoco - origin is uncertain CRTC2 binds CREB and does not make contacts with the DNA (PDB: 4HTM; PMID: 23213254)
CRTC3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Evidence showing that CRTC2, which resembles CERTC3, lacks DNA-binding acitvity. Its reasonable to speculate CRTC3 also lacks ability to bind to DNA
CSRNP1 Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif All three paralogs (CSRNP1, CSRNP2, and CSRNP3) bind an AGAGTG consensus based on SELEX experiments (PMID: 17726538)
CSRNP2 Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif All three paralogs (CSRNP1, CSRNP2, and CSRNP3) bind an AGAGTG consensus based on SELEX experiments (PMID: 17726538)
CSRNP3 Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif All three paralogs (CSRNP1, CSRNP2, and CSRNP3) bind an AGAGTG consensus based on SELEX experiments (PMID: 17726538)
CTBP1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Only known motifs are from Transfac or HocoMoco - origin is uncertain Transfac-only motif with no clear source. This is a known corepressor with a primary function in the Golgi.
CTBP2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
CTH Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
CTNNB1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Only known motifs are from Transfac or HocoMoco - origin is uncertain This is beta catenin - acts as co-factor with TCF/LEF
CTNNBIP1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
CUL1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Component of the E3-ubiquitin ligase complex (PMID: 11961546)
CUL2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
CUL3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
CUL4A Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
CUL4B Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Structure (PDB: 4A0L) shows that CUL4B is recruited to DNA and does not make direct contact with it
CUL5 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
CYLD Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
CYP1B1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
CYTL1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
DAB2IP Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
DACH1 Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has a putative AT-hook Binds with consensus AAWANAAAWAAWT and AATACAATTAAAT as strongest target sequences based on EMSA and SELEX (PMID: 20351289). Protein contains a winged helix structural domain (PMID: 12057194)
DACH2 Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has a putative AT-hook Related to DACH1, which can bind DNA based on EMSA and SELEX (PMID: 20351289). Yet, the fly ortholog has been extensively studied and cannot bind DNA. (PMID: 8431945; PMID: 7821215)
DAP Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein functions in apoptotic signaling
DAXX Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Transcriptional co-repressor
DCP1A Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
DDB1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif DDB1 does not contact the DNA in the structure (PDB: 4E5Z) - contact is mediated by DDB2
DDB2 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif DDB2 contacts the DNA in the (PDB: 4A0K) structure, albeit likely in a non sequence specific manner
DDN Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a putative AT-hook
DDR2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
DDRGK1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
DDX3X Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Protein is a RNA-helicase that can however bind both RNA and DNA (PMID: 21589879). The interaction is presumably nonspecific and a portion of the DNA has to be single-stranded
DDX5 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Transcriptional cofactor (PMID: 15298701)
DDX58 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
DEK Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif This protein binds to cruciform and superhelical DNA and induces positive supercoils into closed circular DNA, and is also involved in splice site selection during mRNA processing. (Entrez gene summary). So it must have some nonspecific DNA affinity.
DEPDC1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Interacts with transcriptional corepressor ZNF224 (PMID: 20587513)
DEPDC1B Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein does not have known DBDs and has been shown to function as an inhibitor of a RhoA-based signaling complex (PMID: 25458010)
DEPDC4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
DEPDC5 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
DEPDC7 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Included only because Vasquerizas 2009 includes it with an x. No DBD and no other data to support being a TF.
DEPTOR Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
DHX34 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
DHX36 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Binds single stranded DNA in the structure (PDB: 2N21)
DISP3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
DMAP1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Component of the NuA4 histone acetyltransferase (HAT) complex, which is involved in transcriptional activation of select genes, principally by acetylation of nucleosomal histones H4 and H2A (PMID: 14966270). (PMID: 20864525) shows DNA binding is sequence independent.
DMC1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
DMRTC1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif This particular DM protein lacks the DM DBD (PMID: 16488114)
DNA2 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Helicase involved in genome integrity. Binds single stranded DNA in the structure (PDB: 5EAN)
DNAJA3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein functions in a chaperone complex
DNAJC21 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Contains a single Matrin-type or U1-type C2H2 domain, which typically binds dsRNA. Its a known heat shock protein that may also be involved in rRNA processing.
DNMT3A Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif DNMT3A and DNMT3B are de novo methyltransferases that are activated by enzymatically inactive paralog DNMT3L. Besides the C-terminal catalytic core, the PWWP domain of 3A and 3B can also bind to DNA. Presumably there is no sequence specificity and instead the de novo methylation complexes are recruited by histone modifications on the N-terminal tail of H3. Reviewed in (PMID: 27826835).
DNMT3B Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif DNMT3A and DNMT3B are de novo methyltransferases that are activated by enzymatically inactive paralog DNMT3L. Besides the C-terminal catalytic core, the PWWP domain of 3A and 3B can also bind to DNA. Presumably there is no sequence specificity and instead the de novo methylation complexes are recruited by histone modifications on the N-terminal tail of H3. Reviewed in (PMID: 27826835).
DNMT3L Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif DNMT3A and DNMT3B are de novo methyltransferases that are activated by enzymatically inactive paralog DNMT3L. Besides the C-terminal catalytic core, the PWWP domain of 3A and 3B can also bind to DNA. Presumably there is no sequence specificity and instead the de novo methylation complexes are recruited by histone modifications on the N-terminal tail of H3. Reviewed in (PMID: 27826835).
DNTT Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Binds single stranded DNA in the structure (PDB: 4I27)
DPF2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif No evidence for DNA-binding activity - possible role in transcriptional regulation complex (PMID: 16785614)
DR1 Unknown Yes Likely to be sequence specific TF 2 Obligate heteromer No motif Binds DNA as a heterotrimeric complex of TBP, DR1, and DRAP1 (PDB: 1JFI)
DRAP1 Unknown Yes Likely to be sequence specific TF 2 Obligate heteromer No motif Based on structure (PDB: 1JFI), it forms the obligate heterodimer DR1-DRAP1 that furthermore contacts TBP. Only makes contact with the minor groove in a histone-like interaction, which is probably non-specific (PMID: 11461703)
DSP Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
DTX1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif This protein is an E3 ligase that operates in the Notch pathway
DUSP12 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
DVL1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
DVL2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif DVL2 does not have any known DBDs; or experimental evidence to suggest it is a TF.
DVL3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
DZIP1L Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Contains a weak ProSite match for a single C2H2 ZF (Uniprot) but not a Pfam match. No experimental evidence for DNA-binding exists
EAF2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif No convincing evidence that this protein binds DNA with any sequence specificity, or that this activity is required for its function. Thus at best the current evidence is that it is a cofactor of some sort cofactor (PMID: 12446457)
EDA Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Cell surface protein that can be cleaved into a secreted one
EDA2R Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Included only because GO says positive regulation of sequence-specific DNA binding transcription factor activity. Not DNA binding.
EDF1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Known co-factor that binds DNA indirectly through interactions with TFs (PMID:12040021)
EDN1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein that is processed into a secreted signaling peptide
EED Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Affects transcription by histone modification (PMID: 16357870)
EGLN1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
EID1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
EID2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Associates with histone deacetylases (PMID: 12586827)
EIF2AK2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
EIF2AK4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
EIF3C Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
EIF3CL Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
EIF3K Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
EME1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Binds DNA in the crystal structure (PDB: 4P0P) in a heterodimeric complex with MUS81.
ENO1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Only known motifs are from Transfac or HocoMoco - origin is uncertain Enolase - DNA binding not shown to be direct
EP300 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Only known motifs are from Transfac or HocoMoco - origin is uncertain p300 is an archetype cofactor. It has many motifs, presumably because many TFs recruit it. Does not contact DNA in the structure (PDB: 3P57)
EP400 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Has a putative AT-hook Protein is a nucleosome remodeling complex component with a role in depositing the H3.3 variant histone into promoter and enhancer regions (PMID: 26669263). Its MYB-like and helicase domains are likely non-specific DNA binding domains
EPHA5 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
EPM2AIP1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein that binds and regulates glycogen synthase allosterically (PMID: 24142699)
ERBIN Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
ERC1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
ERCC3 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Binds DNA in the crystal structure (PDB: 5IY6). Protein is an ATP-dependent 3-5 DNA helicase, so likely non-specific.
ERCC4 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Binds ssDNA at splayed DNA (PDB: 2KN7)
EWSR1 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif
EXO1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Makes contact with ssDNA bases at DNA breaks (PDB: 3QE9)
EXOC2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Plasma-membrane protein functioning in targeting of exocytic vesicles
EXOG Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Endo/exonuclease (5-3), endonuclease G-like. Binds DNA in the crystal structure (PDB: 5T4I), presumably non-specifically
EZH1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Classic polycomb protein.
EZH2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif This is a classic polycomb protein with no evidence of sequence specific DNA binding after years of intense study. I dont see anything in (PMID :15520282) that supports DNA binding.
FAAP24 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Binds DNA backbone from the side of the minor groove in the crystal structure (PDB: 4BXO)
FAM153C Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
FAM171B Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a putative AT-hook
FAM200A Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Protein of unknown function that is conserved in animalia. Has similarities to transposases and zinc fingers, and thus could be a DNA binding protein although there is no evidence supporting this
FAN1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif FANCD2 and FANCI associated nuclease 1. Binds DNA in the crystal structure (PDB: 4REA), presumably non-specifically
FANCA Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Involved in DNA repair (PMID: 8896564)
FANCD2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif DNA repair protein. Inconclusive data supporting sequence-specific binding. Binds NFKB target sites in EMSA using 293T expressing FANCD2 (PMID: 21912593). Since the protein is expressed in mammalian cells, it could still be NFKB mediated binding.
FANK1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Binds JUN to control its activity (PMID: 20978819), but there is no evidence that it binds DNA itself
FARSA Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
FARSB Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif tRNA synthetase
FBN1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
FBXO41 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
FEN1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Involved in DNA replication. Binds DNA in the crystal structure (PDB: 3Q8K), presumably in a non-specific manner.
FER Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
FGD1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
FHL2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif LIM ZF proteins are unlikely to bind DNA. Experimental evidence does not support a role for FHL2 as a sequence-specific DNA-binding protein (PMID:10654935)
FLNA Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Go annotation is based on (PMID: 15684392), which shows that it binds FOXC1 and PBX1 but doesnt show evidence for binding to DNA
FMNL2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
FUBP1 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Only known motifs are from Transfac or HocoMoco - origin is uncertain ssDNA binding protein with crystal structure demonstrating binding to ssDNA (PDB: 1J4W). Its a KH domain protein - this is Levens protein, known to impact the Myc promoter.
FUBP3 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Can bind single stranded DNA in a sequence specific manner (PMID: 8940189). Contans KH domains and has direct evidence it is an RNA-binding protein (PMID: 21252297)
FUS Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif FUS is a well-established RNA-binding protein
FZD1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
FZD2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Transmembrane receptor protein that operates far upstream in the signalling cascade
FZD4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
FZD6 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
GABPB1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Only known motifs are from Transfac or HocoMoco - origin is uncertain Evidence exists showing that GABPB1 (E4TF1-47/53) has no DNA binding activity, but can assocaite with GABPA (E4TF1-60; Ets factor) (PMID: 8441384). Crystal structure of GAPBP1 with GABPA (PDB: 1AWC) clearly shows that the protein makes an extensive protein-protein interaction with GABPA, but does not bind DNA. Transfac PWM is a clear ETS-motif, so GABP1 is unlikely to contact DNA directly
GABPB2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Obligate heteromer with GABPB1 (the alpha subunit) (PMID: 8810337), which together interact with GABPA (PMID: 8441384), but neither contacts the DNA
GADD45A Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Doesnt have any DBDs - likely a co-factor
GAS6 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
GAS7 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif (PMID: 9736752) only shows that it has a proline-rich domain similar to the one in Oct2. No evidence of DNA binding.
GCFC2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif There is some evidence that this protein is an RNA-binding protein (PMID: 24304693).
GEN1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Resolves Holliday junctions. Binds DNA in the crystal structure (PDB: 5T9J)
GLMP Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Binds GATCCGCCCGCTTGTGGCCAACTGGCTCCAGTCAC dsDNA based on EMSA (PMID: 18021396)
GOLGB1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Golgi resident transmembrane protein that regulates glycosylation of other proteins (PMID: 27226319)
GON4L Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Prosite identifies a low-confidence Myb-like domain (e.g., cant decide between Myb, SANT, or no DBD), so its probably not a TF
GPATCH8 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
GPBP1 Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Solid data presented in (PMID: 14612417) Also known as Vasculin. (PMID: 26156556) also claims it has an extended AT hook.
GPBP1L1 Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Possible TF based on similarity to GPBP1. Despite its name, no available evidence for DNA binding. Could also be an RBP according to this screen (PMID: 22658674)
GPER1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
GPR155 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
GREM1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
GRM6 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
GTF2A1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif General transcription factor. Binds DNA in the crystal structure (PDB: 5FUR). The protein contacts the DNA backbone as a heterotrimeric complex that also includes GTF2A2 and TBP. Has an extensive protein-protein interaction interface with the GTF2A2 (that does not contact the DNA) and will probably do nothing without it
GTF2A1L Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
GTF2A2 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif GTF2A2 makes contacts with the DNA backbone (PDB:1NVP; PMID: 12972251), and thus is unlikely to be sequence-specific
GTF2B Unknown Yes Known motif 3 Low specificity DNA-binding protein In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Contacts both DNA and TBP in the structure (PDB: 1C9B)
GTF2E2 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif GTF2E2 weakly binds dsDNA (PMID: 10716934) - unlikely to be sequence-specific
GTF2F1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Does not contact DNA in the structure (PDB: 5IY6)
GTF2F2 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif The protein contacts DNA in the structure (PDB: 5IY6), and could thus have some specificity; DNA is contacted by domain folded from RKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELK.
GTF2H1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif General transcription factor
GTF2H2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif GTF2H2 (p44) is part of the TFIIH complex, but does not contact the DNA based on structural evidence (PDB: 5IVW)
GTF2H2C Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a transcriptional co-regulator (PMID: 9880511)
GTF2H3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Pre-initiation complex component that does not contact DNA in the structure (PDB: 5IVW)
GTF2H4 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif General transcription factor
GTF3C1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Component of RNA polymerase III. Binds weakly to the A-box (PMID: 8164661)
GTF3C2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain GTF3C2 is a general transcription factor of RNA polymerase III and there is no evidence that it binds DNA in the preinitiation complex. Transfac motifs are suspect
H1F0 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Histone. Likely a false-positive Pfam match based on the similarity of Forkhead domains to H1 domains
H1FOO Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Variant linker histone protein that is expressed in oocytes
H1FX Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Histone component
HAVCR2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
HCFC1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is recruited to promoters by THAP11 and ZNF143 and probably does not bind DNA by itself (PMID: 26416877)
HCK Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Inhibits TP73-mediated transcription activation (PMID: 17535448)
HDAC1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Only known motifs are from Transfac or HocoMoco - origin is uncertain Histone deacetylase; likely to be a transcriptional cofactor. Transfac motif is dubious, and the GO annotation (PMID: 8646880) seems to be based on remote homology to a yeast TF
HDAC10 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Histone deacetylase; likely to be a transcriptional cofactor
HDAC2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Only known motifs are from Transfac or HocoMoco - origin is uncertain Histone deacetylase; likely to be a transcriptional cofactor
HDAC3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Histone deacetylase; likely to be a transcriptional cofactor
HDAC4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Histone deacetylase; likely to be a transcriptional cofactor
HDAC5 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Histone deacetylase; likely to be a transcriptional cofactor
HDAC6 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Histone deacetylase; likely to be a transcriptional cofactor
HDAC7 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Histone deacetylase; likely to be a transcriptional cofactor
HDAC8 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
HDAC9 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Histone deacetylase; likely to be a transcriptional cofactor
HELZ2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
HIPK2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Transcriptional cofactor that can act as a coactivator or corepressor. Phosphorylates many transcription factors. (UniProt Q9H2X6)
HIRA Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a putative AT-hook Histone chaperone - TUP1 homolog.
HIST1H1A Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Histone component
HIST1H1B Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Linker histone. To my knowledge there has been no demonstration of sequence specificity of linker histones, so I think this one should be called unlikely.
HIST1H1C Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif
HIST1H1D Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Linker histone that binds DNA as heteromeric complex with the other histone proteins
HIST1H1E Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Binds DNA as heteromultimeric complex
HIST1H1T Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif
HLA-DQB1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
HLA-DQB2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
HLA-DRB1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
HLA-DRB3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
HLA-DRB5 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
HLTF Unknown No ssDNA/RNA binding 4 Not a DNA binding protein In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain DNA repair protein. Even though it has 3 motifs, there is no compelling evidence that it really binds dsDNA - only single stranded DNA
HMOX1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Well characterized enzyme with no additional domains. Included only because GO lists it as a regulator of TFs. No support for DNA binding activity.
HNRNPA1 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Binds single stranded DNA in the structure (PDB: 1PGZ)
HNRNPA3 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Protein is a well established RBP
HNRNPAB Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif HNRNPAB proteins are involved in pre-mRNA splicing. However; RRM domains can also constitute ssDNA binding domains
HNRNPCL2 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Protein is a well established RBP
HNRNPD Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Binds single stranded DNA in the structure (PDB: 1WTB)
HNRNPDL Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Protein is a well established RBP
HNRNPK Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Protein is a well established RBP
HNRNPL Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif HNRNPL is a well-established RNA-binding protein; and the DNA-binding evidence was neither shown to be specific or direct (PMID: 11809897)
HNRNPU Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Binds pre-mRNA in vivo and binds both RNA and ssDNA in vitro (PMID: 1628625)
HP1BP3 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Histone H1-like protein. Binds in ChIP experiments (PMID: 27425409) and binds DNA (likely non-specifically) with HP1.
HR Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif JmjC domain is not a DBD, and GO annotation is based on homology to a zinc finger motif and not experimental DNA-binding evidence (PMID: 9445480)
HSBP1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein that has been shown to bind to HSF1 leading to inhibition of its trimerization and DNA-binding( PMID: 9649501).
HSPA1A Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
HSPA1B Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
ICAM1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
IFI16 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Recognizes DNA without sequence specificity (PMID: 22618232; PMID: 18472023)
IFNB1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
IGHM Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
IKBKB Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
IKBKG Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein binds to NFKB1 to regulate its activity
IL10 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
IL1B Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
IL1RAP Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
IL4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Extracellular signaling molecule. Included as a candidate only because it regulates STAT.
IL5 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
IL6 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
INF2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a putative AT-hook
ING4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Only known motifs are from Transfac or HocoMoco - origin is uncertain Interacts physically with p53 (PMID: 12750254). Transfac motif is derived from ChIP-Chip data, so unclear if it can directly bind DNA
INS Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
IRAK1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
IRAK2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
IRAK3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
IRF2BP1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
ITCH Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
ITGB2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
ITGB3BP Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
IZUMO2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif IZUMO is not considered to be a DNA-binding domain
JADE1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif FYVE and PHD zinc fingers are unlikely to specifically-bind DNA
JAK2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif This is JAK from the classic JAK-STAT pathway. It is included only because GO lists it under positive regulation of sequence-specific DNA binding transcription factor activity. No evidence of sequence specificity - the STATs handle that.
JMY Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Coactivator protein that associates with p300 and TP53 (PMID: 10518217). There is no evidence that it contacts DNA itself. Functions also in actin nucleation (PMID: 19287377).
JUP Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
KANSL2 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Protein is a component of the NSL chromatin remodelling complex
KAT2A Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Histone deacetylase
KAT2B Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Interacts with TFs to modify histones (PMID: 9707565)
KAT5 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Histone acetyltransferase
KAT6A Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Histone deacetylase; likely a transcriptional cofactor
KAT6B Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Co-factor. Could possibly bind to DNA, as a helix- turn-helix DNA-binding motif is present within its MYST-type HAT domain.
KAT8 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif No DBDs, no evidence of TF activity - looks like a chromatin protein. Included only because it has an x in Vaquerizas 2009.
KCNIP3 Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif There are multiple papers showing DREAM can bind DNA (PMID: 10078534, PMID: 11108959).
KDM1A Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Affects transcription by histone modification
KDM3A Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Its a C6 zinc finger and Jumonji-type protein. No DBD.
KEAP1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
KIAA1549 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
KIAA1683 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif No evidence to support a DNA binding function
KIAA1958 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
KIT Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
KNTC1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Rod_C domain localizes to kinetochores but has not been shown to be DNA-binding
KRAS Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
KRBOX1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif KRAB domain only - no DBD or evidence for independent DNA binding
KRTAP5-1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
KRTAP5-9 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
KRTAP9-9 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Keratin-associated protein
LARP1 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Classic RNA binding protein
LARP1B Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif
LARP4 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Classic RNA binding protein
LARP4B Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Classic RNA binding protein
LARP6 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Classic RNA binding protein
LARP7 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Classic RNA binding protein
LGALS9 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
LGR4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
LIG1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif DNA ligase. Binds DNA in the crystal structure (PDB: 1X9N)
LIG3 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif DNA ligase. Binds DNA in the crystal structure (PDB: 3L2P)
LMO2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Only known motifs are from Transfac or HocoMoco - origin is uncertain Protein binds to bHLH TFs, which then bind to DNA (PMID: 9707419). Both transfac motifs are suspect - the bHLH motif likely resulted from an indirect interaction.
LMO4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
LPP Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif znfLIM is probably not a DNA binding domain (PMID: 8506279). The protein has been reported to be coactivator for ETV4 (PMID: 16738319).
LRP5 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif
LRP6 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Cell surface receptor that is in the beginning of the WNT signaling cascade. GO annotation has no evidence of DNA-binding activity (PMID: 14739301).
LRP8 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif
LRRFIP1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Seems to be included only because GO catalogs positive regulation of NF-kappaB transcription factor activity. Nothing that would indicate DNA binding.
LRRFIP2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Its paralog forms a complex with ETS1 that binds AGCCCCCGGCG sequences based on EMSA and SPR (PMID: 16199883). However, direct DNA binding by LRRFIP2 is not demonstrated, and it seems more likely that it is in the complex through protein-protein interactions.
LSR Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Cell plasma membrane resident protein that functions in cell-cell junctions (PMID: 25753034)
LTF Unknown Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
LTN1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
LZTFL1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Lactotransferrin - major iron-binding protein in milk. Two papers from the 1990s (PMID: 7854459; PMID: 1037119) demonstrate strong DNA binding.
LZTR1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
LZTS1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Does not contain a bZIP domain. (PMID: 10097140) does not examine TF activity or DNA binding - GO needs to be corrected.
MACC1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
MACF1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Included only because Vasquerizas 2009 includes it with an x. No DBD and no other data to support being a TF.
MAD2L2 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Likely to be a DNA-binding protein that operates on DNA-repair (PMID: 25799990)
MALT1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein that operates upstream of NFKB in a signaling cascade (PMID: 18223652)
MAML1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif MAML1 does not contact the DNA in the structure (PDB: 2F8X), but contacts RBPJ, which in turn binds DNA
MAML3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
MAP2K5 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Kinase that operates upstream in the signaling cascade that leads to NFKB
MAP3K10 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
MAP3K13 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
MAP3K7 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a kinase
MAPK1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif MAP kinase; protein array paper evidence is not strong
MAPK10 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a kinase
MAPK11 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
MAPK14 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Well characterized MAPK. Included because it as a regulator of several TFs and GO captures this.
MAPK3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
MAPK8 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
MAPK9 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
MATR3 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif An RBP that recognizes MAUCUUR-site based on Ray et al 2013 (PMID: 23846655)
MAVS Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Operates upstream in the signaling cascade that activates innate immunity response for viruses through NFLB and IRF3 TFs
MB21D1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Binds DNA with backbone contacts and one minor groove inserting Arginine in the crystal structure (PDB: 4LEY)
MBTPS2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif GO annotation has no evidence of DNA-binding activity, only modulation of TF activity (PMID: 11163209)
MDFI Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif MDF1 is a co-repressor that inhibits DNA-binding (PMID: 8797820)
MDM2 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif
MDM4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein binds to, and inhibits, p53 (PMID: 9226370)
MED1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif This is a component of Mediator.
MED12 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
MED13 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
MED13L Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
MED14 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
MED15 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
MED16 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif This is a component of Mediator.
MED17 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
MED21 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Does not contact DNA in the structure of the yeast mediator complex (PDB: 5SVA)
MED23 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
MED24 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
MED6 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Does not bind anywhere near DNA on crystal structure (PDB: 4V1O)
MEN1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Interacts with NFKB1 (PMID: 11526476), JUN, JUND, and ELK1 and represses their activities with a mechanism that is at least for JUN and JUND dependent on their phosphorylation
MET Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Its a cell surface receptor and kinase - included only because Vasquerizas 2009 included it with an x.
MGMT Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif O6-Alklyguanine-DNA alkyltransferase (AGT) is an important DNA repair protein that protects cells from mutagenesis and toxicity arising from alkylating agents (PMID: 15964013); structure (PDB: 1YFH) is with cytosine alkylated DNA
MID2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif GO citation (PMID: 23077300) has no evidence of DNA-binding activity
MINK1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
MKL1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Transcriptional co-factor
MKL2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
MKRN3 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Likely E3 ubiquitin ligase. Contains a RING (C3HC4) zinc finger motif and several C3H zinc finger motifs
MLLT1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif X-ray structure indicates histone binding (PDB: 4TMP)
MLLT10 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a putative AT-hook No evidence showing MLLT10 can bind to DNA in a sequence-specific manner (PMID: 7888665)
MLLT11 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
MLLT3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Transcription elongation factor [PMID: 20159561; PMID: 20471948]
MLLT6 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a putative AT-hook Likely to be a transcriptional cofactor based on presence of PHD domains and (PMID: 15588942)
MN1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Evidence for DNA binding not strong in (PMID: 12569362)
MNAT1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
MPG Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif DNA error repair enzyme that excises alkylation-damaged purine bases. Binds dsDNA in the crystal structure (PDB: 1BNK)
MRPL28 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Included only because it has an X in Vaquerizas 2009
MRRF Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
MSH2 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Binds DNA that has a base mismatch as a heterodimer with MSH6. Binds DNA in the crystal structure (PDB: 2O8B)
MSH3 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Involved in mismatch repair - binds dsDNA with indels (PDB: 3THZ) and changes DNA shape
MSH6 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Binds DNA that has base mismatches as a heterodimer with MSH2. Binds DNA in the crystal structure (PDB: 2O8B)
MSL3 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Binds DNA in the crystal structure (PDB: 3OA6). Contacts only the backbone and doesnt cause large changes in the DNA shape
MSRB2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif The paper cited by GO (PMID:10375640) called MSRB2 a TF based on amino acid sequence analysis, but did not provide any direct evidence
MST1R Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
MTDH Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
MTF2 Unknown Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Recent study (PMID: 28869966) demonstrates direct, specific DNA binding to CG-rich sequences through PBMs, and crystal structure in complex with DNA
MTPN Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif No DBD; no evidence for DNA binding - only included because GO says its a positive regulator of NFkappaB.
MUS81 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif MUS81 is a structure-specific endonuclease subunit. It binds DNA in the crystal structure (PDB: 4P0P) in a heterodimeric complex with EME1.
MYBBP1A Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a putative AT-hook Protein that activates TP53 (PMID: 24375404) and binds to MYB (PMID: 24375404); however, there is no evidence of direct binding to DNA
MYCBP Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
MYD88 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Operates upstream in the signaling cascade (PMID: 22155231)
MYEF2 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Binds single-stranded DNA and can regulate transcription in transfection reporter assays
MYOCD Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Transcriptional cofactor (PMID: 12640126)
NAB2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Well characterized transcriptional co-repressor of e.g. EGR1 (PMID: 12427750)
NABP2 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Binds single stranded DNA in the structure (PDB: 4OWW)
NACC2 Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Binds DNA as a homodimer, recognizing a TGTCRSWWYYGWC consensus based on SELEX experiments (PMID: 22926524)
NCOA4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
NCOA5 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Known coactivator with no DBD
NCOA6 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a transcriptional co-regulator (PMID: 10681503)
NCOA7 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Known co-activator; included only because TF-cat documents this
NDN Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
NDP Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Included only because GO says positive regulation of sequence-specific DNA binding transcription factor activity. Not DNA binding.
NEIL1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif DNA glycosylase 1. Binds DNA in the crystal structure (PDB: 5ITR)
NFAM1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif NFAM1 modulates B cell signaling through its immunoreceptor tyrosine-based activation motif, which regulates B cell development (PMID: 15143214)
NFE4 Unknown Yes Known motif 2 Obligate heteromer In vivo/Misc source NFE4 does not posess a DBD. It is a member of the SSP complex that regulates B-globin gene expression, and binds DNA as a heteromer with CP2, based on EMSA (PMID: 7828600; PMID: 15273251). A shorter isoform prevents CP2 binding (PMID: 16263792) and is involved in repression. No gel-shift experiments have been performed in the absence of its partner, CP2, thus its likely an obligate heteromer.
NFKBIA Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif This is I kappa B alpha, which interacts with NFkappaB. No DBD, and evidence indicates that it is not a TF.
NFKBIB Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif From (PMID: 12686541), it appears that the ternary complex is stabilized by an interaction with this protein, which suggests that this protein may offer a conducive electrostatic environment rather directly contributing to the binding event.
NFKBID Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
NFKBIL1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
NFKBIZ Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
NFRKB Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a winged helix but cannot bind to the NFKB consensus.
NFYB Unknown Yes Known motif 2 Obligate heteromer In vivo/Misc source Obligate heterotrimer of NFYA, NFYB, and NFYC
NFYC Unknown Yes Known motif 2 Obligate heteromer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain PDB 4AWL is a very tightly intertwined heterotrimeric complex of NFYA, NFYB and NFYC with a plenty of protein-protein interactions. NFYA contains the recognition alpha-helix but there is no point considering any of the components separately as they are definitely complexed even in the solution and all contribute contacts with the DNA backbone.
NKRF Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Binds AATTTCCTCTGA based on EMSA (PMID: 11071890) and to AATTCCCTGA based on another EMSA (PMID: 16107696)
NLRC3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
NLRC4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
NLRC5 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein inhibits NFKB activity
NLRP12 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
NLRP2B Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
NLRP3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Operates upstream in the signaling cascade
NME2 Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Binds to telomeres (PMID: 22135295). Binds specific sequences by gel-shift, and binding is impacted by a SNP (PMID: 23368879)
NOC3L Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif No evidence to support a DNA binding function
NOC4L Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is associated with ribosome synthesis (PMID: 27798105)
NOCT Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Deadenylase protein that probably regulates genes post-transcriptionally (PMID: 22073225)
NOD1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif NOD-proteins function in signaling cascades that report bacterial peptidoglycans. They activate kinases that in turn activate NFKB proteins etc. Reviewed in (PMID: 25526305)
NOD2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
NODAL Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a secreted signaling molecule
NONO Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif RBP with RRM domains
NOP2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
NOTCH1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif A transmembrane protein that inhibits MEF2C activation (PMID: 10082551). NOTCH1 does not bind DNA in the structure, and is not required for DNA binding, since RBPJ is bound without it in (PDB:4J2X).
NOTCH2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Transmembrane receptor protein that operates far upstream in the signaling cascade
NOTCH3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Fragment of NOTCH. Is a coactivator.
NPM1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif No evidence for sequence-specific DNA-binding (PMID: 2223875)
NR0B2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Transcription cofactor - lacks a conventional DNA binding domain and represses the transcriptional activity of various nuclear receptors (PMID: 14752053)
NRF1 Unknown Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NRG1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Cell surface receptor - does not have predicted DBDs
NRIP1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Transcriptional cofactor
NRIP3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Binds indirectly to DNA through interactions with NHR TFs (PMID: 10860982)
NRK Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a kinase
NSD1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a histone methyltransferase with H3K36 and H4K20 methylation activities (PMID: 12805229)
NTRK1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Membrane bound receptor protein
NUCKS1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Contains a GRP core, which is similar to an AT-hook. But, the amino acids flanking the core are quite different from an AT-hook. Could non-specifically bind to DNA, but lacks compelling evidence.
NUP98 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
OGG1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif DNA error repairing enzyme. Binds DNA in the crystal structure (PDB: 1EBM), presumably without specificity
OPRD1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Transmembrane protein
OTOP3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
OTULIN Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PA2G4 Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Binds CGGCAAAAAGG repeats based on EMSA performed with recombinant E.Coli expressed protein (PMID: 1507318)
PABPN1 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif
PARK7 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Operates upstream in the signaling cascade
PARP1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein In vivo/Misc source DNA repair protein that binds dsDNA non-specifically (PMID: 21183686; PMID: 21262234). The Transfac motifs are likely NFAT target sites
PARP10 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Contains two RRM domains, so likely an RNA-binding protein. Myc-interacting factor capable of ADP-ribosylating itself and core histones (PMID: 15674325).
PAWR Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein that binds to several TFs such as PITX2 (PMID: 19801652) and appears to inactivate them
PAXBP1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has been shown to associate with PAX3 and PAX7, and recruits H3K4 methyltransferase complex (PMID: 22862948). Has a putative DNA-binding domain, so it could contribute to specificity or even function as an independent TF
PAXIP1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Transcriptional coactivator that associates with PAX2 (PMID: 10908331)
PCBD1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Coactivator for HNF1A-dependent transcription. Regulates the dimerization of homeodomain protein HNF1A and enhances its transcriptional activity (UniProt: P61457)
PCBP1 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Crystal structure shows it binds ssDNA (PDB: 1ZTG).
PCBP2 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Protein is an RBP. Structure (PDB:2PQU) is with single stranded DNA
PCBP3 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif KH domain suggests that this is an RNA-binding protein
PCGF2 Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif (PMID: 8521824) shows via SELEX and EMSA that the recombinant PCGF2 protein binds GACT repeats
PCGF6 Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Binds GACTNGACT based on SELEX and EMSA performed in (PMID: 8521824)
PCNA Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Binds DNA in the crystal structure (PDB: 5L7C). Protein barely contacts the DNA at all
PCSK6 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PDCD7 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif No DBD. No evidence for sequence-specific DNA binding. Included only because TFcat says its a cofactor.
PDS5B Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a putative AT-hook
PELI1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Ubiquitin ligase
PER1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein that associates with CLOCK-ARNTL heterodimers to silence the expression of their target genes (PMID: 16987893)
PER2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein that operates in the circadian clock through binding to and inhibiting the ARNTL-CLOCK heterodimer. Does not bind DNA itself )PMID: 16987893)
PER3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PEX14 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PFDN1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PGBD1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif PiggyBac Transposable Element Derived 1. Contains a SCAN domain and interacts with other SCAN proteins (see Q96JS3). Interpro also lists without ref that it has sequence specific DNA binding activity (IEA code). No concrete evidence available.
PGS1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PHB Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is likely a mitochondrial chaperone and thus its roles associated with transcription are likely to be very indirect (PMID: 10835343)
PHB2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein has been shown to bind to TFs and function as a co-repressor. There appears to be no evidence for direct DNA-binding activity (PMID: 18629613)
PHF1 Unknown Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Recent study (PMID: 28869966) demonstrates direct, specific DNA binding to CG-rich sequences through PBMs, and crystal structure in complex with DNA
PHF19 Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Recent study (PMID: 28869966) demonstrates direct, specific DNA binding to CG-rich sequences of related proteins through PBMs, and crystal structure in complex with DNA
PHF5A Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif This is a known spliceosomal protein with a PhD domain. I dont see the evidence that it binds the GJA1/Cx43 promoter, as listed on GeneCards. The reference cited does not mention this protein as far as I can see. In any case, binding could be indirect - the most likely role in transcription for a PHD domain protein would be as a cofactor.
PHTF1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Despite its name, does not have a detectable Homeodomain. No available evidence for DNA binding.
PHTF2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Contains a Transcription factor homeodomain, male germ-cell domain (INTERPRO:IPR021980, PFAM:PF12129) that does not have any known DNA-binding activity. Its name comes from a fly ortholog that does contain a homeobox; but, the human gene does not.
PIAS1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif The protein contains a SAP motif, which has been annotated as a putative DNA-binding motif without supporting experimental evidence (PMID:10694879)
PIAS2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Sumoylates transcription factors to modulate their activities (PMID: 22406621; PMID: 15976810; PMID: 15920481)
PIAS3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif PIAS-proteins regulate transcription factors by sumoylating them (PMID: 12077349)
PIAS4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif No DBD. No evidence of DNA binding - its a known cofactor
PIDD1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Operates upstream in the NFKB signaling cascade
PIKFYVE Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Included only because its in Vasquerizas 2009 with an x. No DBD and no other evidence of DNA binding.
PIM1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Affects transcription by phosphorylating TFs (PMID: 18593906)
PINK1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PKHD1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif The TIG domain is potentially DNA-binding but there is no literature evidence to suggest that PKHD1 is a TF. Membrane protein that operates upstream in the signaling cascade leading to NFKB (PMID: 21300060)
PKHD1L1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Membrane receptor (PMID: 12620974)
PLA2G10 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PLA2G1B Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PLEK Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif The DEP-domain is a winged helix-turn-helix protein domain, and thus it is related to ETS, RFX, and FOX domains. However, there is no evidence for DNA-binding activity and it has been shown to operate in G-protein signalling upstream of TFs
PLEK2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PLEKHA4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a putative AT-hook No DBDs; no indication of DNA binding - included only because Vasquerizas 2009 included it with an x.
PLPP3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PLSCR1 Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif PLSCR1 has been demonstrated to bind a GTAACCATGTGGA sequence in the IP3R1 promoter (PMID:16091359), mediated by a specific portion of the protein.
PLXNA1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a semaphorin receptor that operates far upstream on the signaling cascade.
PLXNA2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a semaphorin receptor that operates far upstream on the signaling cascade.
PLXNA3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a semaphorin receptor that operates far upstream on the signaling cascade.
PLXNA4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a semaphorin receptor that operates far upstream on the signaling cascade (PMID: 12591607).
PLXNB1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a semaphorin receptor that operates far upstream on the signaling cascade.
PLXNB2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PLXNB3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a semaphorin receptor that operates far upstream on the signaling cascade.
PLXNC1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PLXND1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a semaphorin receptor that operates far upstream on the signaling cascade.
PML Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Likely a transcriptional cofactor. Does not have any clear DBDs. RING-fingers are more typically protein-protein interaction domains
PNKP Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Binds DNA in the crystal structure (PDB: 3ZVN)
POGZ Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Has a potential DBD that is similar to Drosophila Brinker but no other data suggesting TF function. Likely co-factor.
POLA1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Binds DNA in the crystal structure (PDB: 4Q5V)
POLB Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif DNA polymerase that participates in base excision repair. Binds DNA in the crystal structure (PDB: 1BPX)
POLE3 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif
POLE4 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Histone-like subunit of DNA polymerase epsilon
POLG Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Binds DNA in the crystal structure (PDB: 4ZTU)
POLH Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif DNA polymerase. Binds DNA in the crystal structure (PDB: 3JAA)
POLI Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif DNA polymerase. Binds DNA in the crystal structure (PDB: 1T3N)
POLK Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif DNA polymerase. Binds DNA in the crystal structure (PDB: 2OH2)
POLL Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif DNA polymerase. Binds DNA in the crystal structure (PDB: 1RZT)
POLM Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif DNA polymerase that operates on non-homologous end joining. Binds DNA in the crystal structure (PDB: 2IHM)
POLN Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Binds DNA in the crystal structure (PDB: 4XVI)
POLQ Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Binds DNA in the crystal structure (PDB: 4X0P)
POLR1B Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif General Transcription Factor
POLR2A Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Contacts DNA in the structure (PDB: 5FLM)
POLR2B Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Contacts DNA in the structure (PDB: 5FLM)
POLR2E Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif RNA-polymerase subunit. Binds DNA in the crystal structure (PDB: 5IY6)
POLR2J Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Does not contact DNA in the structure (PDB: 5FLM)
POLR2K Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Does not contact DNA in the structure (PDB: 5FLM)
POLR2L Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Does not contact DNA in the structure (PDB: 5FLM)
POLR3A Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Transfac motifs are dubious, and do not appear to be similar to any known motifs.
POLRMT Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Binds DNA in the crystal structure (PDB: 4BOC)
POT1 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Binds single stranded DNA in the structure (PDB: 1XJV)
POU2AF1 Unknown Yes Known motif 2 Obligate heteromer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Requires POU2F1 to bind DNA. In the crystal structure (PDB:1CQT), POU2AF1 contacts both the POU2F1 and DNA major groove
PPARGC1A Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif
PPARGC1B Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Contains a single RRM domain, so could possibly be an RNA binding protein
PPP1R13L Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PPP2R3B Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PPP2R5B Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PPP3CA Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PPRC1 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif
PQBP1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a WW domain. May interact with Pol II, but no indication of sequence specific DNA binding
PRAM1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PRAP1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PRB3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Human salivary glycoprotein
PRDM7 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Only has KRAB and SET domains - no C2H2 ZFs.
PRDX3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PREB Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif In vitro gel-shift experiments show that PREB binds specific promoter sequences (PMID: 10194769; PMID: 19426980) without the presence of a canonical DBD
PREX1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Included only because Vasquerizas 2009 includes it with an x. No DBD and no other data to support being a TF.
PREX2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PRH2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PRIM2 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Binds DNA-RNA hybrid in the structure (PDB: 5F0Q)
PRIMPOL Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Involved in DNA replication. Binds DNA in the crystal structure (PDB: 5L2X), presumably non-specifically.
PRKCB Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PRKCH Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a kinase that activates another kinase leading to degradation of NFKB inhibitor NFKBIA (PMID: 21820409)
PRKCI Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Kinase that operates upstream in the signaling cascade that leads to NFKB
PRKCQ Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PRKCZ Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PRKD1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PRKD2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PRKN Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a ubiquitin ligase
PRMT2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PRNP Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PSMA6 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PSMC5 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PSMD10 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif GO annotation has no evidence of DNA-binding activity; only modulation of NF-kappaB activity (PMID: 18040287)
PSMD11 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PSMD12 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PSPC1 Unknown No ssDNA/RNA binding 3 Low specificity DNA-binding protein No motif Contains RRMs and no DBDs. Mouse orhtolog has been found in androgen receptor complexes (PMID: 16641145) but no DNA-binding activity has been shown.
PTCH1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PTEN Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PTGIS Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif It is a cytochrome p450 enzyme
PTH Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PTTG1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif GO annotation has no evidence for DNA-binding activity (PMID:9811450), only transcriptional activation in reporter experiments
PUM3 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Binds dsDNA in the crystal structure (PDB: 4WZW). Makes extensive contacts with the backbone that cause shape changes and could possibly lead to specificity.
PURA Unknown Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Binds dsDNA (PMID: 15282343) and ssDNA (PMID: 1448097) specifically
PURB Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Binds dsDNA (PMID: 15282343) and ssDNA (PMID: 1448097) specifically
PURG Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Paralogs PURA and PURB bind dsDNA (PMID: 15282343) and ssDNA (PMID: 1448097) specifically.
PYCARD Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PYDC1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
PYDC2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein that regulates NFKB activity
QRICH1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
RAB7B Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein activates NFKB (PMID: 20953574)
RAD21 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Motifs are suspicious; protein is a component of the cohesin complex and there is no evidence for direct binding to DNA.
RAD51 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Functions in homologous recombination DNA-repair. Binds DNA with low specificity (PMID:10390347)
RAG1 Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Binds DNA specifically (PMID: 10066757)
RAI1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Chromatin remodeler
RAPGEF3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif No DBD and no evidence its a TF - included only because it has an x in Vaquerizas 2009
RAPGEF4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
RAPGEF5 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
RB1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Classic co-factor
RBBP7 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
RBCK1 Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Fairly well-studied E3 ubiquitin-protein ligase. But EMSA data exist demonstrating binding to TGG-containing DNA (PMID: 9514928)
RBL1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
RBL2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Transcriptional co-repressor
RBM10 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif RNA-binding protein
RBM20 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Likely an RNA-binding protein
RBM22 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif RNA binding protein (PMID: 17045351)
RBM26 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif RNA-binding protein (PMID: 22681889; PMID: 22658674)
RBM27 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Likely an RNA-binding protein
RBM5 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif RNA-binding protein that binds RNA with two RRM-domains and regulates splicing (PMID: 24486491)
RBM6 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif RNA-binding protein that binds RNA with two RRM-domains and regulates splicing (PMID: 24332178)
RCAN1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif SH3 domain protein that interacts with calcineurin. GO annotation and abstract in (PMID: 8595418) appear erroneous - mentions a binding domain in the abstract, but no evidence is provided in the paper.
RECQL Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif ATP dependent DNA helicase. Binds DNA in the crystal structure (PDB: 2WWY)
RELL2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
RELN Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a large secreted extracellular matrix protein
REV1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif DNA polymerase. Binds DNA in the crystal structure (PDB: 3GQC)
REXO4 Unknown Yes Likely to be sequence specific TF 3 Low specificity DNA-binding protein No motif REXO4 (hPMC2) has been shown to bind ERE containing sequences in gel-shift experiments (PMID: 10908561) in complex with ERbeta. However, figures containing the gel-shifts have been cropped to exclude the unshifted free DNA band so it is hard to judge the evidence.
RFC1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif DNA-dependent ATPase. Binds DNA (contact with major groove and backbone) in the crystal structure (PDB: 2K7F)
RFXANK Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif AKA RFX-B. No DBD, no motifs produced when tested, no evidence of independent DNA binding. (PMID: 9806546) shows that its interaction with RFX5 and RFXAP is essential for binding of the RFX complex to MHC-II promoters, but it does not bind DNA on its own.
RFXAP Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Included because TF-CAT calls it a cofactor and GO erroneously calls it sequence-specific DNA binding.
RGCC Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
RGS11 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a putative AT-hook
RGS6 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
RGS7 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
RGS9 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
RHEBL1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
RING1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif RING1 is a well-characterized member of the Polycomb complex. No reference to DNA-binding in literature search on EntrezGene
RIOK2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
RIPK1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
RIPK2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein activates NFKB through its kinase activity
RIPK3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Kinase protein
RIPK4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
RLIM Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif LIM ZF proteins are unlikely to bind DNA
RNASE2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
RNASEH1 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Ribonuclease H1. Binds DNA-RNA hybrid in structure (PDB: 2QKB)
RNF114 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
RNF125 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a ubiguitin ligase
RNF138 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif DNA repair protein. RNF138 is recruited to DNA damage sites through zinc fingers that have a strong preference for DNA with 5- or 3-single-stranded overhangs. (PMID: 26502055)
RNF14 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Transcriptional cofactor
RNF166 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a ubiquitin ligase (PMID: 26456228)
RNF2 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Forms non-specific DNA contacts according to crystal structure (PMID: 25355358)
RNF25 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Probably a co-regulator; no clear evidence for direct binding to DNA
RNF31 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif
RNF4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a ubiquitin ligase (PMID: 18408734)
RNF41 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a ubiquitin ligase
RPA2 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif
RPA4 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif ssDNA binding protein involved in DNA repair (PMID: 7760808)
RPL7 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Binds DNA by filter binding (PMID: 8441630), but competition assays suggest it is non-specific. A specific dsRNA structure is thought to be the preferred substrate. RNA-binding has been demonstrated by gel-shift experiments (PMID: 10329420).
RPL7A Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
RPS27A Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif
RPS6KA4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
RPS6KA5 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif No DBD - its a kinase. Included only because GO says its an upstream regulator of CREB and NF-kappaB
RRN3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
RUNX1T1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
RWDD3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Included because GO says negative regulation of NF-kappaB transcription factor activity. No DBD, no motif, etc
RYBP Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Contains RanBP ZFs, so likely an RNA-binding protein
S100A12 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
S100A8 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
S100A9 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
SAFB Unknown Yes Likely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Based on this review the protein is likely to bind AT-rich DNA in a non-sequence specific manner (PMID: 27888239)
SAFB2 Unknown Yes Likely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Bind AT-rich DNA elements and RNA (PMID: 27888239)
SAV1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
SCAND1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
SCAND2P Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Pseudogene
SCAPER Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Involved in cell cycle regulation in the cytoplasm (PMID: 17698606)
SCMH1 Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has a SLED domain (IPR021987). (PMID: 24727478) claims, based on NMR, that SLED is a sequence-specific DBD with relatively high specificity
SCML1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Homologous to polycomb proteins, so likely a transcriptional cofactor (PMID: 9570953). Has putative roles in the testis development and spermatogenesis (PMID:18601738). Reference cited by GO provides no evidence of DNA-binding activity (PMID: 9570953).
SCML2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Part of the polycomb repressor complex that functions in male, establishing the male germline epigenome through regulation of histone H2A ubiquitination (PMID: 25703348)
SEMA4A Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
SERTAD1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Transcriptional co-factor; no evidence for DNA-binding activity
SERTAD2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Transcriptional cofactor that associates with E2F/TFDP heterodimers (PMID: 19152710). Does not contain any DBDs
SETD6 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Methyltransferase to the NF-kappaB complex (PMID: 21131967) and histones (PMID: 23324626)
SF3A2 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Functions in splicing
SF3A3 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif RNA-binding protein
SFPQ Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Splicing factor - contains 2 RRM domains
SFRP4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
SFRP5 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
SFTPB Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
SGK1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
SGK3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein kinase that operates upstream in the signaling cascade
SHH Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
SHPRH Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
SIGIRR Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
SIK1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
SIN3A Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Only known motifs are from Transfac or HocoMoco - origin is uncertain Motifs are suspect and probably reflect DNA binding specificities of SIN3 contacted TFs. SIN3 does not have any DBDs and is thought to function as a scaffold protein that connects TFs to HDAC complexes. Reviewed in (PMID: 19505602)
SIN3B Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Can be tethered to DNA by Mad-Max, but does not appear to have any specificity (PMID: 7889570)
SIRT1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
SIRT2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
SIRT3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a histone de-acetylase
SIRT6 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Only known motifs are from Transfac or HocoMoco - origin is uncertain No canonical DBD, but it does bind at least one sequence-specific DNA binding protein (TRF2). Seems more likely to be a cofactor.
SIVA1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Affects transcription through interactions with NF-kappaB (PMID: 16491128)
SKI Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Conflicting evidence. Binds specifically to GTCTAGAC via EMSA in one study (PMID: 9452486). But, needs to form complexes with other proteins, such as NFI, to bind to DNA in another (PMID: 9380514). Related to SKIL, which also has evidence for DNA binding (PMID: 9824161)
SKIDA1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
SKIL Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Homodimerizes on GTCTAGAC sequence (EMSA) (PMID: 9824161)
SKOR1 Unknown Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SLC22A4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a transmembrane protein of the plasmamembrane
SLC26A10 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
SLC26A3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Included as a candidate only because GO cites a 1993 paper where sequence analysis identified a homeodomain. But, there seems to be no homeodomain.
SLC30A9 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
SLC39A10 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
SLC4A10 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
SMARCA2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a putative AT-hook No clear DBD, and its a known cofactor
SMARCA4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a putative AT-hook (PMID: 24752179) shows via ChIP that it has DNA mediated regulatory activity, but unknown if this is direct or indirect binding. No clear DBD present in the protein.
SMARCAL1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Is a DNA binding helicase
SMARCB1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Alias INI1 is a minor groove DNA-binding protein (PMID: 19398554)
SMARCD1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif It is an active ATP-utilizing chromatin remodeling protein (PMID: 25818293)
SMARCD2 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Transcriptional cofactor (PMID: 8804307)
SMARCD3 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Chromatin remodelling complex component
SMC3 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Binds and compacts DNA as a SMC1-SMC3 heterodimer that is part of the cohesin complex (PMID: 23620281). Transfac motifs likely reflect the binding of other TFs such as CTCF that associate with cohesin
SMO Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif The protein is a G-protein coupled receptor
SMUG1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Involved in DNA mismatch repair. Xenopus homolog binds dsDNA in the crystal structure (PDB: 1OE4)
SMYD1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
SMYD3 Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Binds GGAGGG elements based on SELEX performed using GST fusion protein (PMID: 15235609)
SNAPC2 Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Recognizes the PSE-element, which is located in the core promoters of snRNA genes, and helps to recruit TBP (PMID: 8633057)
SNAPC5 Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Binds specifically to the PSE (PMID: 9732265)
SNRPC Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Component of the spliceosomal U1 snRNP
SNURF Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Likely a TF co-factor
SNW1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
SOGA3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Does not contain any likely DBDs.
SON Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif The protein has been reported to bind a GAKANSRCC consensus based on SELEX experiments. Recognizes a matching GAGACCACC sequence in a hepatitis B virus regulatory element (PMID: 11306577)
SORBS2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
SPEN Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Has a putative AT-hook Data inconclusive. Contains RRM domains, suggesting RNA binding activity. Gel-shift experiments demonstrate that SPEN (aka MINT) binds ss and dsDNA G- and T-rich elements (PMID: 10451362), but in another system SPEN does not bind DNA directly and is recruited (PMID: 15778499). RNA-binding activities have also been documented (PMID: 24748666).
SPHK1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
SPZ1 Unknown Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Binds to E-boxes (EMSA) (PMID: 15226296)
SSB Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Binds to the 3 poly(U) terminus of nascent RNA polymerase III transcripts, protecting them from exonuclease digestion and facilitating their folding and maturation (PMID: 3192525; PMID: 2470590]
SSBP2 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Binds single stranded DNA in DNA damage response. Has domain IPR008116 Sequence-specific single-strand DNA-binding protein
SSBP3 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Single stranded DNA binding protein. There is no evidence for sequence specificity, although it can operate as a transcriptional co-regulator (PMID: 26495868)
SSBP4 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif (PMID:9531483) shows that the SSDP_DNA-bd domain has sequence-specific single-stranded DNA-binding activity.
SSH1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
SSH2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
SSH3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
SSX1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
STAG1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a putative AT-hook Part of the cohesin complex
STK16 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
STK3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Kinase - included only because GO says it regulates TFs
STK36 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
STRN Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
STRN3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif GO annotation has no evidence for DNA-binding activity (PMID: 11570823), and STRN3 lacks a canonical DBD
SUB1 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif The structure (PDB: 2C62) demonstrates binding to single stranded DNA
SUFU Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
SUMO1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
SUPT16H Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Component of the FACT histone remodeling complex, which functions in transcriptional elongation (PMID: 12934006). (PDB: 4Z2M) shows that the protein contacts H3 and H4 proteins, but it could also contact DNA
SUPT4H1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Involved in transcription elongation (PMID: 9450929)
SUPT5H Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Protein that regulates transcriptional elongation (PMID: 9450929)
SUPT6H Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif SPT6 is an elongation factor, not a TF. GO needs to be corrected - (PMID: 8786132) does not demonstrate sequence specificity or DNA binding.
SUV39H1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a histone methyltransferase that trimethylates lysine 9 of histone H3
SUV39H2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Histone (H3K9) methyltransferase. Also directs DNA methylation (UniProt: Q9H5I1) (PMID: 14765126)
SUZ12 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Protein is a component of the PRC2 repressor complex, which silences DNA through histone methylation. The protein has two znf C2H2-like domains that appear to be used in association with chromatin (PMID: 24100017)
SYK Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Known co-factor
TAB1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TAB2 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Works as a protein-protein interaction adapter to recruit TAK1-kinase (PMID: 10882101). Could also work as an RBP, based on presence of a zf-RanBP domain
TAB3 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif
TADA3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a putative AT-hook Paper cited by GO annotation has no evidence of specific DNA-binding activity (PMID: 9674425), and is based on experiments using an entire complex
TAF1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Contacts DNA in the structure (PDB: 5FUR). Transfac motifs are suspect, and are probably in vivo signals derived from promoter binding TFs (e.g. YY1 and ETS)
TAF10 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif General transcription factor
TAF11 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Does not interact with DNA (PMID: 15657423)
TAF12 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif (PMID: 15601843) shows it has DNA binding activity in a complex with TAF4b.
TAF13 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Forms heterodimer TAF11:TAF13, which has a histone-fold like structure and could thus bind DNA in a non- or low specific manner (PMID: 9695952)
TAF1A Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif General TF. Directly binds to DNA, likely in a non sequence-specific manner (PMID: 15970593), although it is possible it might have some specificity.
TAF1B Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Pol I TAF that contacts the rDNA promoter in conjunction with TBP and UBF (PMID: 7491500). No clear evidence that it directly confers sequence specificity.
TAF1C Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Component of the transcription factor SL1/TIF-IB complex, which is involved in the assembly of the PIC.
TAF1L Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Involved in preinitiation complex assembly (general transcriptional machinery. Is a paralog of TAF1, which binds DNA based on the structure (PDB: 5FUR)
TAF2 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Directly contact with DNA in TFIID complex (PMID: 27096372), and mediate major interactions with the downstream promoter together with TAF1. Contacts DNA in the structure (PDB: 5FUR)
TAF3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Contacts chromatin through modified histones and TFs such as TP53 (PMID: 18549481)
TAF4 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif The TAF4 domain interacts with TAF12 and makes a novel histone-like heterodimer that binds DNA and has a core promoter function for of a subset of genes (PMID: 19635797; PMID: 12237304)
TAF4B Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Histone-like protein that binds DNA as an obligate heterodimeric complex with TAF12 (PMID: 19635797). Target sequence needs to be over 70 bases long and doesnt appear to have sequence specificity
TAF5 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TAF5L Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Paralog of TAF5 that is unlikely to contact DNA (PMID: 17227857)
TAF6 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Does not contact DNA in the structure (PDB: 5FUR)
TAF6L Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Part of the PCAF Histone Acetylase Complex (PMID: 9674425). Structurally similar to TAF6, which does not contact DNA directly
TAF7 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Does not contact DNA in the structure (PDB: 5FUR)
TAF7L Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TAF8 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Does not contact DNA in the structure (PDB: 5FUR)
TAF9 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Related to histone H3. (PMID: 15601843) shows DNA binding activity in complex with TAF4b, but does not demonstrate intrinsic sequence specificity. May contact promoter DNA (PMID: 23292512)
TAF9B Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TARDBP Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Is an RNA-binding protein that can also bind single stranded DNA, as in the structure (PDB: 3D2W)
TAX1BP1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TBL1Y Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif No DBD. Included as a candidate only because TFcat lists it as a putative coactivator.
TCEA2 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Likely binds RNA based on similarity to TCEA1
TCEAL1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TCEAL7 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Modulates transcription, but there is no evidence for DNA binding (PMID: 19966855)
TCEAL8 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Lacks a canonical DBD
TCF19 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a putative AT-hook Previous evidence (PMID: 1868030) for TF activity is based on sequence analysis (high proline content), and presence of an FHA domain. However, neither prove ability to bind DNA in a sequence-specific manner
TCF20 Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif (PMID: 7760812) identified this protein in a library screen and demonstrated DNA binding of an IVT product to an enhancer of interest. They also identified a putative bZIP domain that is not detected by Pfam or SMART. (PMID:10995766) subsequently mapped the strongest DNA binding site.
TCF25 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Only evidence is based on (PMID:16574069), which claims that hnulp1 (TCF25) contains a possible bHLH domain and that it represses transcription in a Gal4-forced recruitment assay.
TDG Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif TDG is specific for G/T mispairs in DNA (PDB: 2RBA; PMID: 18587051). Some evidence exists for TDG affecting transcription through interactions with NHR TFs (PMID: 9694815), suggesting it could also be a transcriptional co-factor
TDP1 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Binds single stranded DNA in the structure (PDB: 1NOP)
TDP2 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Binds single stranded DNA in the structure (PDB: 4F1H)
TET2 Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Binds DNA in the crystal structure (PDB: 4NM6). Oxidizes 5-methylcytosine (5mC).
TGFB1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TGFB1I1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Available evidence suggests that it acts as a co-factor
TGS1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is an RNA-modifying enzyme (PMID: 19307714)
THRAP3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
THYN1 Unknown Yes Likely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Binds DNA in the crystal structure (PDB: 5J3E). Recognizes 5mC containing DNA. Contacts the DNA backbone from the side of the minor groove and has an arginine that inserts into the minor groove.
TIA1 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Has an RRM domain. Binds single stranded DNA in the structure (PDB: 5ITH)
TICAM1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TIPARP Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TIRAP Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TLE1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Transcriptional co-factor
TLE2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TLE3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a putative AT-hook Protein is a transcriptional co-regulator (PMID: 21459326)
TLE4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif TLE4 is a Groucho protein (co-repressor)
TLE6 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Transcriptional cofactor that associates with FOXG1 (PMID: 16314515)
TLR2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Upstream of NFKB and not involved in DNA-binding
TLR3 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Binds dsRNA (PMID: 16111635)
TLR4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TLR9 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Protein is a nonmethylated CpG dsDNA recognizing protein that operates in the innate immune response to pathogen invasion of the cell. It isnt a TF, but it binds pathogenic DNA (PMID: 11564765). Binds single-stranded DNA in the structure (PDB: 3WPC)
TMEM235 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Transmembrane protein
TMF1 Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Bacterially-expressed protein binds specifically to the TATA element to compete with TBP, based on EMSA (PMID: 1409643)
TNF Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif The protein is a secreted cytokine and operates far upstream in the signaling cascade
TNFAIP3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Inhibits NFKB-activation. No evidence for direct binding to DNA
TNFRSF11A Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TNFRSF4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Operates far upstream in the signaling cascade
TNFSF11 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TNFSF18 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a cytokine
TNFSF4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Extracellular signaling molecule. Included only because it regulates TFs.
TONSL Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Binds to the N-terminal tail of Histone H4 (PMID: 27338793, PDB: 5JA4). It is likely a histone chaperone (PMID: 26527279) and thus probably forms nonspecific contacts with DNA.
TOP1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif DNA topoisomerase. Binds DNA in the crystal structure (PDB: 1A31).
TOP2A Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif DNA topoisomerase. Binds DNA in the crystal structure (PDB: 4FM9).
TOP2B Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif DNA topoisomerase. Binds DNA in the crystal structure (PDB: 3QX3).
TOPORS Unknown Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
TP53BP1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a putative AT-hook
TRADD Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Regulates transcription by binding to the adaptor protein TRAF2, leading to reduction of recruitment of inhibitor-of-apoptosis proteins. No evidence for binding DNA (PMID: 18309324)
TRAF1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif TRAF1 is an NF-kappaB interactor (PMID: 10692572), and is unlikely to have DNA-binding activity
TRAF2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Does not contain any canonical DBDs
TRAF3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TRAF4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Operates far upstream in the signaling cascade
TRAF5 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Operates far upstream in the signaling cascade
TRAF6 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TRAPPC9 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TREX1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Has weak exonuclease activity for GAG, ACA, and CTGC DNA sequences (PMID: 17355961)
TRIB1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Associates with CEBPB and CEBPA and inhibits their activities (PMID: 17724128). This is probably achieved through control of their proteosomal degradation (PMID: 17576771)
TRIB3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Disabled kinase - binds NFkappaB and ATF4, but no evidence for direct sequence specific DNA binding.
TRIM13 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Operates far upstream in the signaling cascade. Ring fingers usually operate in protein-protein interactions
TRIM14 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TRIM15 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TRIM21 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TRIM22 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TRIM23 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TRIM24 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Known cofactor. Included because TF-CAT documents this. Does not have any canonical DBDs.
TRIM25 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TRIM26 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TRIM27 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Evidence presented in (PMID: 1437549) for DNA-binding of alias RFP is not strong - if anything, this is likely a non-specific DNA binder
TRIM28 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Only known motifs are from Transfac or HocoMoco - origin is uncertain This protein a well-known co-repressor and is recruited to DNA by KRAB-domain containing TFs. Transfac motifs are likely from interacting proteins
TRIM29 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Previous evidence for TF activity (PMID: 8188213) is based on sequence analysis and does not provide DNA-binding evidence. Based on EntrezGene information, its likely a transcriptional co-factor
TRIM3 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Contains multiple NHL domains, which bind RNA (see, for example, LRP8).
TRIM31 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TRIM32 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif
TRIM33 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TRIM34 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TRIM37 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Included only because GO says it is a regulator of NFkappaB. No evidence for DNA binding, and no canonical DBD.
TRIM38 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TRIM40 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein that promotes post-translational modification of an NBKB-inhibitor protein (PMID: 21474709)
TRIM5 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif No DBD and no evidence for DNA binding. Included as a candidate only because GO says its a regulator.
TRIM52 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Established ubiquitin ligase that targets at least one viral protein (NS2A) of Japanese Encephalitis Virus to proteosomal degradation (PMID: 27667714)
TRIM62 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a ubiguitin ligase (PMID: 23402750)
TRIM8 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TRIP11 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Structural component of the Golgi-apparatus (PMID: 19112494)
TRIT1 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Protein is a tRNA modifying enzyme (PMID: 15870694)
TRMT1L Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TRRAP Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a component of histone acetyltransferase complexes
TSC2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TSC22D1 Unknown Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif TSC22D1 appears to homo- and heterodimerize with other TFs to affect transcription (PMID: 10488076). In vitro, it has been shown to bind GC-rich DNA sequences (PMID: 9022669)
TSC22D2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif There is some evidence that a related protein (TSC22D1) binds DNA specifically - thus, it is possible this is also a TF.
TSC22D3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif There is some evidence that a related protein (TSC22D1) binds DNA specifically - thus, it is possible this is also a TF.
TSC22D4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif There is some evidence that a related protein (TSC22D1) binds DNA specifically - thus, it is possible this is also a TF.
TSN Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Based on (PMID: 20450889) and (PMID: 12484770), this protein binds repetitive DNA sequences as multimeric complexes that may contain partner protein TSNAX
TSSK4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
TUB Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif The Tubby C-terminal domain (IPR000007; PF01167) has been shown to impart nuclear localization and bind select dsDNA sequences in gel-shift experiments (PMID: 10591637). This article hypothesized that this domain constitutes a bona fide sequence specific TF, but no concrete evidence for this exists to date
TULP4 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif (PMID: 10591637) shows that it binds dsDNA. All other research, however, supports phosphoinositide-binding as the major function of the tubby domain.
TUT1 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif
TXK Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Experimental evidence for DNA-binding was performed with nuclear extract - thus, the apparent specific-binding of TXK could be due to indirect binding (PMID: 11859127). In addition a whitepaper suggests that this interaction could not be replicated (Miskimins, Beth)
U2AF1 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Well-established RNA binding protein
U2AF1L4 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Related to U2AF1, so likely also an RNA binding protein.
UBA52 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
UBB Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
UBC Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
UBE2K Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
UBE2N Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
UBE2V1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Ubiquitin ligase
UBN1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Interacts with bZIP transcription factors (PMID: 10725330)
UBR4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
UBTFL6 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Pseudogene According to ENSEMBL this is a Pseudogene, and it is of uncertain confidence in Uniprot. The most similar gene, UBTLF1, is annotated as No evidence for or against specific DNA-binding by this class of HMG box containing proteins.
UFL1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
UHRF1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Structural evidence (PDB:2ZO0; PDB: 2ZO1; PMID: 18772888] and (PDB: 2ZKE) (PMID: 18772891) demonstrate direct DNA-binding. However, the extent to which it is sequence specific beyond hemimethylated DNA has not been extensively explored.
UHRF2 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Binds DNA in the crystal structure contacting the minor groove and backbone (PDB: 4PW5). Recognizes 5hmC-containing DNA (PDB: 4PW5)
UNG Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Involved in mismatch repair. Excises uracil bases from DNA. Binds DNA in the crystal structure (PDB: 1EMJ)
USP39 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
USP7 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
UTF1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
VAV1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Paper cited by GO annotation (PMID: 2477241) only presents evidence based on sequence similarity to a ZF motif, and other evidence (PMID: 11994417) only supports a role in coactivation of NFAT and NFKB without direct DNA-binding
VEGFA Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Extracellular signaling molecule. Included only because it regulates CREB.
VGLL1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Likely transcriptional cofactor (PMID: 10518497)
VGLL2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Co-activator that binds TEF family TFs (PMID: 14762206)
VGLL3 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif (PMID: 23380592) describes this protein as a co-activator, and it doesnt seem to have a DBD (fig. 1)
VHLL Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Interacts with TFs as part of an E3 ubiquitin ligase complex (PMID: 12682018). No evidence for DNA binding.
VPS72 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif VPS72 (YL1) is a histone chaperone. YL1 binding to the H2A.Z-H2B dimer is mutually exclusive from the dimer binding DNA (PMID: 26974126)
WFS1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
WNT1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
WNT10B Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a secreted signaling protein
WNT2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
WNT3A Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
WNT5A Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif (PMID: 19847889) shows this protein as a part of a large EMSA shifting complex with RNA-Pol1, CHD1, and other DNA binding proteins. It does not, however, show evidence for it binding to DNA directly
WNT8B Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif WNT family signaling molecule (PMID: 9536085)
WRN Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif ATP dependent DNA helicase. Binds DNA in the crystal structure (PDB: 3AAF)
WWOX Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Co-factor of AP-2 (PMID: 15548692)
WWP2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
WWTR1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Transcriptional co-activator that binds to TEADs (PMID: 19324877) and TBX5 (PMID: 16332960)
XCL1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a secreted chemokine
XPA Unknown Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Functions in DNA repair (PMID: 19197159), but has a strong HT-SELEX-derived motif.
YEATS2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
YEATS4 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Lacks a DBD and the study cited by GO annotation (PMID: 9302258) doesnt have experimental evidence for DNA-binding
YOD1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
ZBED6CL Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif No DBDs on UniProt or Ensembl
ZBP1 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif ZBP1 is structurally-specific for Z-DNA, but does not have any sequence specificity (PDB: 1J75; PMID: 11524677)
ZCCHC11 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Likely a ssDNA or RNA binding protein based on domain composition
ZCCHC6 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif (PMID: 23709223) shows that it binds single-stranded nucleid acids
ZDHHC11 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif
ZDHHC19 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif ER transmembrane protein
ZMAT2 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Possibly an RBP based on presence of a U1 ZF domain
ZNF137P Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Pseudogene Pseudogene
ZNF185 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a putative AT-hook Protein has a LIM-subtype ZF. This type of ZF is not likely to bind DNA (PMID: 17696879)
ZNF638 Unknown No Unlikely to be sequence specific TF 3 Low specificity DNA-binding protein No motif Binds C-rich dsDNA with low affinity (PMID: 8647861).
ZNF720 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Contains a KRAB domain (associated with many C2H2 ZFs), but no annotated C2H2 on PDB or UniProt
ZNF738 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Contains a KRAB domain (associated with many C2H2 ZFs), but no annotated C2H2 on PDB or UniProt
ZNF862 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a putative AT-hook Contains a KRAB domain (associated with many C2H2 ZFs), but no annotated C2H2 on PDB or UniProt
ZNFX1 Unknown No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Probably an RBP (PMID: 22658674; PMID: 22681889)
ZRANB2 Unknown No ssDNA/RNA binding 4 Not a DNA binding protein No motif Its the wrong kind of zinc finger to bind DNA. Likely binds RNA. PMID cited by GO (PMID: 9931435) does not have evidence of sequence-specific DNA binding.
TP53 p53 Yes Known motif 1 Monomer or homomultimer In vivo/Misc source
TP63 p53 Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TP73 p53 Yes Known motif 1 Monomer or homomultimer In vivo/Misc source
PAX1 Paired box Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PAX5 Paired box Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PAX8 Paired box Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PAX9 Paired box Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
LCOR Pipsqueak Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
LCORL Pipsqueak Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PROX1 Prospero Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
PROX2 Prospero Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
NFAT5 Rel Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NFATC1 Rel Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NFATC2 Rel Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NFATC3 Rel Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NFATC4 Rel Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NFKB1 Rel Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NFKB2 Rel Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
REL Rel Yes Known motif 1 Monomer or homomultimer In vivo/Misc source
RELA Rel Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Can bind as a homodimer or heterodimer (PMID: 22101729)
RELB Rel Yes Known motif 2 Obligate heteromer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Likely an obligate heteromer (PMID: 22101729)
RFX1 RFX Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
RFX2 RFX Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
RFX3 RFX Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
RFX4 RFX Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
RFX5 RFX Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Has a putative AT-hook
RFX6 RFX Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
RFX7 RFX Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
RFX8 RFX Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif RFX8 has the HUGO-approved name RFX family member 8, lacking RFX DNA binding domain?.? I cannot find the original evidence, however, and RFX8 clearly encodes a complete and high-confidence RFX DNA binding domain.? So, it seems more likely than not to be DNA binding (TRH)
RUNX1 Runt Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
RUNX2 Runt Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
RUNX3 Runt Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
AIRE SAND Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Binds to TTATTA and tandem repeats of ATTGGTTA (PMID: 11533054)
DEAF1 SAND Yes Inferred motif 1 Monomer or homomultimer In vivo/Misc source
GLA SAND No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif GLA appears to lack a functional SAND domain. It encodes a well-characterized enzyme, Galactosidase Alpha. Most of the polypeptide encodes a glycoside hydrolase domain and most of the rest encodes another pfam domain called Glycoside hydrolase family 27. It has a low-scoring SAND domain match that almost certainly overlaps with a known domain related to its function as an enzyme.
GMEB1 SAND Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
GMEB2 SAND Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SKOR2 SAND Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SP100 SAND Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Gel-shift experiments using human SP100 have shown binding to specific TTCG half sites (PMID: 11427895).
SP110 SAND Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
SP140 SAND Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
SP140L SAND Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
SART1 SART-1 No ssDNA/RNA binding 4 Not a DNA binding protein No motif Likely an RNA-binding protein
RPL36A SBP No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Protein is a ribosomal component
NFIA SMAD Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NFIB SMAD Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NFIC SMAD Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
NFIX SMAD Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SMAD1 SMAD Yes Known motif 2 Obligate heteromer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Well-established obligate heteromer
SMAD2 SMAD No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Only known motifs are from Transfac or HocoMoco - origin is uncertain A 30 amino-acid insertion encoded by exon 3 is thought to displace the hairpin loop, providing a structural explanation for SMAD2s lack of DNA-binding activity (PMID: 11532220).
SMAD3 SMAD Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SMAD4 SMAD Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro
SMAD5 SMAD Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
SMAD6 SMAD No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Only known motifs are from Transfac or HocoMoco - origin is uncertain In the inhibitory Smads, Smad6 and Smad7 and DAD, the MH1 domains are replaced by divergent amino-termini that share regions of similarity within the inhibitory Smad subgroup (PMID: 11532220).
SMAD7 SMAD No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Only known motifs are from Transfac or HocoMoco - origin is uncertain In the inhibitory Smads, Smad6 and Smad7 and DAD, the MH1 domains are replaced by divergent amino-termini that share regions of similarity within the inhibitory Smad subgroup (PMID: 11532220).
SMAD9 SMAD Yes Known motif 2 Obligate heteromer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
STAT1 STAT Yes Known motif 1 Monomer or homomultimer In vivo/Misc source
STAT2 STAT Yes Known motif 1 Monomer or homomultimer In vivo/Misc source
STAT3 STAT Yes Known motif 1 Monomer or homomultimer In vivo/Misc source
STAT4 STAT Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
STAT5A STAT Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
STAT5B STAT Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain Can form both homodimers and heterodimers with STAT5A (PMID: 9528750)
STAT6 STAT Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Only known motifs are from Transfac or HocoMoco - origin is uncertain
EOMES T-box Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
MGA T-box Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Has a putative AT-hook Some isoforms also contain a predicted bHLH domain, but it is unlike any other known bHLH domain and the MGA motif looks like a standard T-box motif, so the bHLH domain is likely a false positive
T T-box Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TBR1 T-box Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TBX1 T-box Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TBX10 T-box Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
TBX15 T-box Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TBX18 T-box Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TBX19 T-box Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TBX2 T-box Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TBX20 T-box Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TBX21 T-box Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TBX22 T-box Yes Known motif 1 Monomer or homomultimer In vivo/Misc source
TBX3 T-box Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TBX4 T-box Yes Known motif 1 Monomer or homomultimer High-throughput in vitro Available motifs suggest facultative homodimeric binding
TBX5 T-box Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TBX6 T-box Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TBP TBP Yes Known motif 1 Monomer or homomultimer 100 perc ID - in vitro Binds DNA in the pre-initiation complex
TBPL1 TBP Yes Likely to be sequence specific TF 2 Obligate heteromer No motif A more distant paralog of TBP and the only member of the TBP family that lacks the ability to bind the TATA box. (PMID: 21711503). In vitro, purified TLF-TFIIA binds directly to the NF1 promoter (PMID: 15767669), so likely an obligate heteromer.
TBPL2 TBP Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro
LIN54 TCR/CxC Yes Inferred motif 1 Monomer or homomultimer High-throughput in vitro In the structure (PDB: 5FD3), the protein contacts DNA, although it only contacts the backbone except for one tyrosine residue
TESMIN TCR/CxC No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif Has a double CxC DBD structure. One is eroded, and it did not produce a motif on PBMs. So, either it has lost its ability to bind DNA, or the experiment failed for some reason.
APOA4 TEA No Unlikely to be sequence specific TF 4 Not a DNA binding protein No motif APOA4 is Apolipoprotein A4. It consists entirely of Apolipoprotein A1/A4/E domains. The protein product is excluded from the nucleus. I cant see that it has a TEA domain. I believe it is likely to be a low-scoring domain match that almost certainly overlaps with a known domain related to its function as an enzyme. Thus it is unlikely to be a DNA binding protein.
TEAD1 TEA Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TEAD2 TEA Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TEAD3 TEA Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
TEAD4 TEA Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
THAP1 THAP finger Yes Known motif 1 Monomer or homomultimer In vivo/Misc source Likely binds as a homodimer
THAP10 THAP finger Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Paralog THAP1 binds DNA in a sequence specific manner
THAP11 THAP finger Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif (PMID: 26876175) has a ChIP-seq motif with GGGARWTGTAGT consensus. THAP11 is an atypical zinc-finger paralogous to THAP1, which has a crystal structure (PDB: 2KO0) where the protein contacts bases TGGGCA
THAP12 THAP finger Yes Known motif 1 Monomer or homomultimer High-throughput in vitro
THAP2 THAP finger Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
THAP3 THAP finger Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
THAP4 THAP finger Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
THAP5 THAP finger Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
THAP6 THAP finger Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
THAP7 THAP finger Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
THAP8 THAP finger Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif
THAP9 THAP finger Yes Likely to be sequence specific TF 1 Monomer or homomultimer No motif Human THAP9 Gene Encodes an Active P-Element DNA Transposase (PMID: 23349291)
ZFAND5 ZZ-type ZF No ssDNA/RNA binding 4 Not a DNA binding protein No motif An RNA-binding protein that recognises 3UTR located AU-rich elements in mRNA molecules to stabilize them (PMID: 22665488)